
Sort by:
{"id":4369967251492,"title":"Colourworks Cheese Servers, Set Of 4 (k33a)","handle":"four-piece-cheese-server-set","description":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\"\u003eThis knife set is made of durable, high-quality stainless steel coated with classic muted colours. They’re rust-resistant and easy to clean too, ready to get you through year upon year of cheese and wine nights, buffet spreads and all the cheese cravings in-between. Includes 3 stainless steel cheese knives and a cheese fork. Handwash only\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2020-11-05T12:09:38+00:00","created_at":"2019-11-18T22:08:34+00:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT","TABLE \u0026 BAR"],"price":895,"price_min":895,"price_max":895,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":31234940403748,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"CWCLCHEESESET","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Colourworks Cheese Servers, Set Of 4 (k33a)","public_title":null,"options":["Default Title"],"price":895,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250784933","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/pastelcheeseknifeset.jpg?v=1712865011","\/\/\/cdn\/shop\/products\/fourpiecepastelcheeseset.jpg?v=1712865011"],"featured_image":"\/\/\/cdn\/shop\/files\/pastelcheeseknifeset.jpg?v=1712865011","options":["Title"],"media":[{"alt":null,"id":46275431203161,"position":2,"preview_image":{"aspect_ratio":1.0,"height":567,"width":567,"src":"\/\/\/cdn\/shop\/files\/pastelcheeseknifeset.jpg?v=1712865011"},"aspect_ratio":1.0,"height":567,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/pastelcheeseknifeset.jpg?v=1712865011","width":567},{"alt":null,"id":21164294275108,"position":3,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/products\/fourpiecepastelcheeseset.jpg?v=1712865011"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/fourpiecepastelcheeseset.jpg?v=1712865011","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\"\u003eThis knife set is made of durable, high-quality stainless steel coated with classic muted colours. They’re rust-resistant and easy to clean too, ready to get you through year upon year of cheese and wine nights, buffet spreads and all the cheese cravings in-between. Includes 3 stainless steel cheese knives and a cheese fork. Handwash only\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
Colourworks Cheese Servers, Set Of 4 (k33a)

Colourworks Cheese Servers, Set Of 4 (k33a)


This knife set is made of durable, high-quality stainless steel coated with classic muted colours. They’re rust-resistant and easy to clean too, ready to get you through year upon year of cheese and wine nights, buffet spreads and all the cheese cravings in-between. Includes 3 stainless steel cheese knives and a cheese fork. Handwash only

More Info
Barcraft Wine Bottle Thermometer Sleeve (k79a)
{"id":383774162980,"title":"Barcraft Wine Bottle Thermometer Sleeve (k79a)","handle":"wine-bottle-thermometer-sleeve","description":"Bar Craft easy to use wine thermometer and guide. Simply slip the thermometer sleeve over the bottle and the temperature lights up on the sleeve. Suitable for red and white wine, with suggested temperatures for most wines. Wipe clean only. Gift boxed","published_at":"2020-12-11T12:42:56+00:00","created_at":"2017-11-21T17:03:56+00:00","vendor":"Kitchencraft","type":"","tags":["**Offers**","KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":840,"price_min":840,"price_max":840,"available":true,"price_varies":false,"compare_at_price":1050,"compare_at_price_min":1050,"compare_at_price_max":1050,"compare_at_price_varies":false,"variants":[{"id":4975451832356,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCTHERM","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Barcraft Wine Bottle Thermometer Sleeve (k79a)","public_title":null,"options":["Default Title"],"price":840,"weight":0,"compare_at_price":1050,"inventory_quantity":5,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250135650","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/Winebottlethermometersleeve_1_8f26d613-b5dc-4486-91de-901f3ff28134.jpg?v=1671646784","\/\/\/cdn\/shop\/products\/winebottlethermometer_8016b994-92e6-4cf7-b22a-8f189b20719c.jpg?v=1671645255","\/\/\/cdn\/shop\/products\/winebottlethermometersleeve._1_1.jpg?v=1671645255"],"featured_image":"\/\/\/cdn\/shop\/products\/Winebottlethermometersleeve_1_8f26d613-b5dc-4486-91de-901f3ff28134.jpg?v=1671646784","options":["Title"],"media":[{"alt":null,"id":23324983590948,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/products\/Winebottlethermometersleeve_1_8f26d613-b5dc-4486-91de-901f3ff28134.jpg?v=1671646784"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/Winebottlethermometersleeve_1_8f26d613-b5dc-4486-91de-901f3ff28134.jpg?v=1671646784","width":600},{"alt":null,"id":21157664948260,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/products\/winebottlethermometer_8016b994-92e6-4cf7-b22a-8f189b20719c.jpg?v=1671645255"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/winebottlethermometer_8016b994-92e6-4cf7-b22a-8f189b20719c.jpg?v=1671645255","width":600},{"alt":null,"id":23174139772964,"position":3,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/products\/winebottlethermometersleeve._1_1.jpg?v=1671645255"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/winebottlethermometersleeve._1_1.jpg?v=1671645255","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Bar Craft easy to use wine thermometer and guide. Simply slip the thermometer sleeve over the bottle and the temperature lights up on the sleeve. Suitable for red and white wine, with suggested temperatures for most wines. Wipe clean only. Gift boxed"}
Barcraft Wine Bottle Thermometer Sleeve (k79a)

Barcraft Wine Bottle Thermometer Sleeve (k79a)


Bar Craft easy to use wine thermometer and guide. Simply slip the thermometer sleeve over the bottle and the temperature lights up on the sleeve. Suitable for red and white wine, with suggested temperatures for most wines. Wipe clean only. Gift boxed

More Info
{"id":385084784676,"title":"Barcraft Stainless Steel Cocktail Compass (k734)","handle":"luxe-lounge-stainless-steel-cocktail-compass","description":"Perfect the art of cocktails with this Luxe Lounge stainless steel cocktail compass. Spin to reveal twelve cocktail recipes including cosmopolitan, long island ice tea, margarita and mojito. All there is left to do for you is to follow the recipe and enjoy your delicious cocktails. Luxe Lounge from Bar Craft – the art deco inspired cocktail collection for luxurious lounge living at home. Wipe clean only. 12 month guarantee.","published_at":"2022-02-01T14:19:25+00:00","created_at":"2017-11-22T14:30:01+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":1195,"price_min":1195,"price_max":1195,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4985303040036,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"bcllcompass","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Barcraft Stainless Steel Cocktail Compass (k734)","public_title":null,"options":["Default Title"],"price":1195,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250426734","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/kitchencraftcocktaildrinkscompass._2290f049-a022-4b91-9178-3b75b20ccd35.jpg?v=1712953157","\/\/\/cdn\/shop\/files\/stainlesssteelcocktailcompass.jpg?v=1712953141","\/\/\/cdn\/shop\/files\/kitchencraftcocktaildrinkscompass..jpg?v=1712953171"],"featured_image":"\/\/\/cdn\/shop\/files\/kitchencraftcocktaildrinkscompass._2290f049-a022-4b91-9178-3b75b20ccd35.jpg?v=1712953157","options":["Title"],"media":[{"alt":null,"id":46288898982233,"position":2,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/\/cdn\/shop\/files\/kitchencraftcocktaildrinkscompass._2290f049-a022-4b91-9178-3b75b20ccd35.jpg?v=1712953157"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/kitchencraftcocktaildrinkscompass._2290f049-a022-4b91-9178-3b75b20ccd35.jpg?v=1712953157","width":700},{"alt":null,"id":46288873521497,"position":3,"preview_image":{"aspect_ratio":0.667,"height":600,"width":400,"src":"\/\/\/cdn\/shop\/files\/stainlesssteelcocktailcompass.jpg?v=1712953141"},"aspect_ratio":0.667,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/stainlesssteelcocktailcompass.jpg?v=1712953141","width":400},{"alt":null,"id":46288887120217,"position":4,"preview_image":{"aspect_ratio":1.007,"height":695,"width":700,"src":"\/\/\/cdn\/shop\/files\/kitchencraftcocktaildrinkscompass..jpg?v=1712953171"},"aspect_ratio":1.007,"height":695,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/kitchencraftcocktaildrinkscompass..jpg?v=1712953171","width":700}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Perfect the art of cocktails with this Luxe Lounge stainless steel cocktail compass. Spin to reveal twelve cocktail recipes including cosmopolitan, long island ice tea, margarita and mojito. All there is left to do for you is to follow the recipe and enjoy your delicious cocktails. Luxe Lounge from Bar Craft – the art deco inspired cocktail collection for luxurious lounge living at home. Wipe clean only. 12 month guarantee."}
Barcraft Stainless Steel Cocktail Compass (k734)

Barcraft Stainless Steel Cocktail Compass (k734)


Perfect the art of cocktails with this Luxe Lounge stainless steel cocktail compass. Spin to reveal twelve cocktail recipes including cosmopolitan, long island ice tea, margarita and mojito. All there is left to do for you is to follow the recipe and enjoy your delicious cocktails. Luxe Lounge from Bar Craft – the art deco inspired cocktail col...

More Info
{"id":6602013343780,"title":"Artesà Slate Serving Platter With Brushed Metal Handles, 60cm","handle":"artesa-appetiser-slate-serving-platter","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eShowcase a smorgasbord of antipasti, desserts or entrees with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal handles also make it easy to carry around to guests and also to use as a tray for serving individual dessert or dipping pots. Make a statement. Part of the Artesà range of hand finished dining and serving items. Wipe clean only. 5 year guarantee. Size: 60cm x 15cm. Includes: 1 x slate serving platter and 2 x metal handles. Gift boxed\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-05-02T12:38:33+01:00","created_at":"2021-05-02T12:33:18+01:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":2295,"price_min":2295,"price_max":2295,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39395178151972,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTPLATTER","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Slate Serving Platter With Brushed Metal Handles, 60cm","public_title":null,"options":["Default Title"],"price":2295,"weight":0,"compare_at_price":null,"inventory_quantity":7,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250480859","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/servinggrazingslateplatter_d653021f-6c99-44b2-b9b5-c3f86b0efe13.jpg?v=1712786979","\/\/\/cdn\/shop\/products\/ARTPLATTERservingplattergrazingplatter.jpg?v=1712786822","\/\/\/cdn\/shop\/products\/ARTPLATTER_10servingplattergrazingplatter.jpg?v=1712786822"],"featured_image":"\/\/\/cdn\/shop\/files\/servinggrazingslateplatter_d653021f-6c99-44b2-b9b5-c3f86b0efe13.jpg?v=1712786979","options":["Title"],"media":[{"alt":null,"id":46265629835609,"position":1,"preview_image":{"aspect_ratio":1.631,"height":544,"width":887,"src":"\/\/\/cdn\/shop\/files\/servinggrazingslateplatter_d653021f-6c99-44b2-b9b5-c3f86b0efe13.jpg?v=1712786979"},"aspect_ratio":1.631,"height":544,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/servinggrazingslateplatter_d653021f-6c99-44b2-b9b5-c3f86b0efe13.jpg?v=1712786979","width":887},{"alt":null,"id":20423758676004,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/ARTPLATTERservingplattergrazingplatter.jpg?v=1712786822"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/ARTPLATTERservingplattergrazingplatter.jpg?v=1712786822","width":500},{"alt":null,"id":20423758708772,"position":4,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/ARTPLATTER_10servingplattergrazingplatter.jpg?v=1712786822"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/ARTPLATTER_10servingplattergrazingplatter.jpg?v=1712786822","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eShowcase a smorgasbord of antipasti, desserts or entrees with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal handles also make it easy to carry around to guests and also to use as a tray for serving individual dessert or dipping pots. Make a statement. Part of the Artesà range of hand finished dining and serving items. Wipe clean only. 5 year guarantee. Size: 60cm x 15cm. Includes: 1 x slate serving platter and 2 x metal handles. Gift boxed\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Slate Serving Platter With Brushed Metal Handles, 60cm

Artesà Slate Serving Platter With Brushed Metal Handles, 60cm


Showcase a smorgasbord of antipasti, desserts or entrees with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal handles also make it easy to carry around to guests and also to use as a tra...

More Info
{"id":383775211556,"title":"Wrap Around adjustable Silver Wine Cooler (k07s)","handle":"wrap-around-silver-wine-cooler","description":"Highly versatile Bar Craft bottle and drinks cooler. Using adjustable velcro fastenings the sleeve simply wraps around to fit any type and size of bottle, can, or carton to chill it in under five minutes. Folds flat for portability and easy storage. Wipe clean only. Gift boxed.","published_at":"2020-11-05T12:34:59+00:00","created_at":"2017-11-21T17:04:55+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":1195,"price_min":1195,"price_max":1195,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4975460843556,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCWRAP","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Wrap Around adjustable Silver Wine Cooler (k07s)","public_title":null,"options":["Default Title"],"price":1195,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250134707","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/wraparoundwinecooler.jpg?v=1636754719","\/\/\/cdn\/shop\/products\/wraparoundwinecooler..jpg?v=1636754734"],"featured_image":"\/\/\/cdn\/shop\/products\/wraparoundwinecooler.jpg?v=1636754719","options":["Title"],"media":[{"alt":null,"id":21173856895012,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/products\/wraparoundwinecooler.jpg?v=1636754719"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/wraparoundwinecooler.jpg?v=1636754719","width":600},{"alt":null,"id":21173856862244,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/wraparoundwinecooler..jpg?v=1636754734"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/wraparoundwinecooler..jpg?v=1636754734","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Highly versatile Bar Craft bottle and drinks cooler. Using adjustable velcro fastenings the sleeve simply wraps around to fit any type and size of bottle, can, or carton to chill it in under five minutes. Folds flat for portability and easy storage. Wipe clean only. Gift boxed."}
Wrap Around adjustable Silver Wine Cooler (k07s)

Wrap Around adjustable Silver Wine Cooler (k07s)


Highly versatile Bar Craft bottle and drinks cooler. Using adjustable velcro fastenings the sleeve simply wraps around to fit any type and size of bottle, can, or carton to chill it in under five minutes. Folds flat for portability and easy storage. Wipe clean only. Gift boxed.

More Info
{"id":4538504118308,"title":"Artesà Wood Antipasti Footed Serving Platter, 37cm","handle":"antipasti-wood-footed-serving-platter-medium","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eServe in style! The obvious choice for serving antipasti, tapas, entrees and desserts to friends and family, this large serving board adds a lovely natural contemporary feel to your evenings. The trendy plank adds an extra level to your table, it maximizes space and is ideal for serving food made to share. Hand finished acacia wood. Handwash only. 5 year guarantee.  Size: 37cm x 12cm x 13 cm. Gift boxed\u003cbr\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2022-12-21T18:51:34+00:00","created_at":"2020-03-07T16:55:15+00:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":3150,"price_min":3150,"price_max":3150,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":31740249112612,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTSBmed","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Wood Antipasti Footed Serving Platter, 37cm","public_title":null,"options":["Default Title"],"price":3150,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250520319","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/ARTSBMED_serving_platter_footed_2.jpg?v=1632328699","\/\/\/cdn\/shop\/products\/ARTSBMED_serving_platter_footed.jpg?v=1583600266"],"featured_image":"\/\/\/cdn\/shop\/products\/ARTSBMED_serving_platter_footed_2.jpg?v=1632328699","options":["Title"],"media":[{"alt":null,"id":6461184999460,"position":1,"preview_image":{"aspect_ratio":1.257,"height":389,"width":489,"src":"\/\/\/cdn\/shop\/products\/ARTSBMED_serving_platter_footed_2.jpg?v=1632328699"},"aspect_ratio":1.257,"height":389,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/ARTSBMED_serving_platter_footed_2.jpg?v=1632328699","width":489},{"alt":null,"id":6461185032228,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/ARTSBMED_serving_platter_footed.jpg?v=1583600266"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/ARTSBMED_serving_platter_footed.jpg?v=1583600266","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eServe in style! The obvious choice for serving antipasti, tapas, entrees and desserts to friends and family, this large serving board adds a lovely natural contemporary feel to your evenings. The trendy plank adds an extra level to your table, it maximizes space and is ideal for serving food made to share. Hand finished acacia wood. Handwash only. 5 year guarantee.  Size: 37cm x 12cm x 13 cm. Gift boxed\u003cbr\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Wood Antipasti Footed Serving Platter, 37cm

Artesà Wood Antipasti Footed Serving Platter, 37cm


Serve in style! The obvious choice for serving antipasti, tapas, entrees and desserts to friends and family, this large serving board adds a lovely natural contemporary feel to your evenings. The trendy plank adds an extra level to your table, it maximizes space and is ideal for serving food made to share. Hand finished acacia wood. Handwash o...

More Info
{"id":384866156580,"title":"Lever-Arm Power Arc Corkscrew With Foil Cutter (K11F)","handle":"lever-arm-power-arc-corkscrew-with-foil-cutter","description":"A deluxe Bar Craft corkscrew with a geared action lever-arm mechanism for effortless cork removal. Finished with a satin touch matt black body with contrasting chrome fittings. Includes a twist action foil cutter, non-stick coated worm, and a spare worm. Wipe clean only. See full care and use instructions.","published_at":"2023-11-03T08:51:25+00:00","created_at":"2017-11-22T10:54:17+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":3995,"price_min":3995,"price_max":3995,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4983941955620,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCAUTOPULL","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Lever-Arm Power Arc Corkscrew With Foil Cutter (K11F)","public_title":null,"options":["Default Title"],"price":3995,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250160911","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/kitchencraftleverarmpowercorkscrew..jpg?v=1712950100","\/\/\/cdn\/shop\/products\/leverarmcorkscrewkitchencraft.jpg?v=1636238347","\/\/\/cdn\/shop\/products\/leverarmcorkscrew_fa786fd2-ba1b-48f2-a9e9-fb145d31276e.jpg?v=1636238360"],"featured_image":"\/\/\/cdn\/shop\/products\/kitchencraftleverarmpowercorkscrew..jpg?v=1712950100","options":["Title"],"media":[{"alt":null,"id":21135384477732,"position":1,"preview_image":{"aspect_ratio":1.0,"height":521,"width":521,"src":"\/\/\/cdn\/shop\/products\/kitchencraftleverarmpowercorkscrew..jpg?v=1712950100"},"aspect_ratio":1.0,"height":521,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/kitchencraftleverarmpowercorkscrew..jpg?v=1712950100","width":521},{"alt":null,"id":21135379038244,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/leverarmcorkscrewkitchencraft.jpg?v=1636238347"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/leverarmcorkscrewkitchencraft.jpg?v=1636238347","width":500},{"alt":null,"id":21135379071012,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/leverarmcorkscrew_fa786fd2-ba1b-48f2-a9e9-fb145d31276e.jpg?v=1636238360"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/leverarmcorkscrew_fa786fd2-ba1b-48f2-a9e9-fb145d31276e.jpg?v=1636238360","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"A deluxe Bar Craft corkscrew with a geared action lever-arm mechanism for effortless cork removal. Finished with a satin touch matt black body with contrasting chrome fittings. Includes a twist action foil cutter, non-stick coated worm, and a spare worm. Wipe clean only. See full care and use instructions."}
Lever-Arm Power Arc Corkscrew With Foil Cutter (K11F)

Lever-Arm Power Arc Corkscrew With Foil Cutter (K11F)


A deluxe Bar Craft corkscrew with a geared action lever-arm mechanism for effortless cork removal. Finished with a satin touch matt black body with contrasting chrome fittings. Includes a twist action foil cutter, non-stick coated worm, and a spare worm. Wipe clean only. See full care and use instructions.

More Info
{"id":6799040806948,"title":"Artesà Slate Serving Platter with Copper Handles, 60cm","handle":"artesa-hand-finished-serving-platter-with-copper-handles","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eArtesà Hand Finished Serving Platter with Copper Handles, 60cm. Showcase Artesà Hand Finished Serving Platter with Copper Handles, 60cm Artesà Hand Finished Serving Platter with Copper Handles, 60cm a smorgasbord of antipasti, desserts or entrées with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal copper coloured handles also make it easy to carry around to guests and also to use as a tray for serving individual dessert or dipping pots. Wipe clean only. Set includes: 1 x slate serving platter. 2 x copper handles. Size: 60cm x 15cm x 3.5cm. Gift boxed.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-11-01T22:41:03+00:00","created_at":"2021-11-01T22:34:39+00:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":2250,"price_min":2250,"price_max":2250,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39677677961252,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTPLATTERCOP","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Slate Serving Platter with Copper Handles, 60cm","public_title":null,"options":["Default Title"],"price":2250,"weight":0,"compare_at_price":null,"inventory_quantity":5,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250687401","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/ARTPLATTERCOP_21slateservingplatter_1.jpg?v=1635806510","\/\/\/cdn\/shop\/products\/ARTPLATTERCOPslateservingplatter.jpg?v=1635806324","\/\/\/cdn\/shop\/products\/ARTPLATTERCOP_10slateservingplatter.jpg?v=1635806357"],"featured_image":"\/\/\/cdn\/shop\/products\/ARTPLATTERCOP_21slateservingplatter_1.jpg?v=1635806510","options":["Title"],"media":[{"alt":null,"id":21106468225060,"position":1,"preview_image":{"aspect_ratio":1.408,"height":426,"width":600,"src":"\/\/\/cdn\/shop\/products\/ARTPLATTERCOP_21slateservingplatter_1.jpg?v=1635806510"},"aspect_ratio":1.408,"height":426,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/ARTPLATTERCOP_21slateservingplatter_1.jpg?v=1635806510","width":600},{"alt":null,"id":21106460393508,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/products\/ARTPLATTERCOPslateservingplatter.jpg?v=1635806324"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/ARTPLATTERCOPslateservingplatter.jpg?v=1635806324","width":600},{"alt":null,"id":21106462556196,"position":3,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/products\/ARTPLATTERCOP_10slateservingplatter.jpg?v=1635806357"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/ARTPLATTERCOP_10slateservingplatter.jpg?v=1635806357","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eArtesà Hand Finished Serving Platter with Copper Handles, 60cm. Showcase Artesà Hand Finished Serving Platter with Copper Handles, 60cm Artesà Hand Finished Serving Platter with Copper Handles, 60cm a smorgasbord of antipasti, desserts or entrées with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal copper coloured handles also make it easy to carry around to guests and also to use as a tray for serving individual dessert or dipping pots. Wipe clean only. Set includes: 1 x slate serving platter. 2 x copper handles. Size: 60cm x 15cm x 3.5cm. Gift boxed.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Slate Serving Platter with Copper Handles, 60cm

Artesà Slate Serving Platter with Copper Handles, 60cm


Artesà Hand Finished Serving Platter with Copper Handles, 60cm. Showcase Artesà Hand Finished Serving Platter with Copper Handles, 60cm Artesà Hand Finished Serving Platter with Copper Handles, 60cm a smorgasbord of antipasti, desserts or entrées with this natural slate serving platter. The natural black tone and uneven texturing adds a stylis...

More Info
{"id":923854798884,"title":"Italian Glass Dual Oil \u0026 Vinegar Cruet Bottle (k78s)","handle":"world-of-flavours-italian-glass-dual-oil-vinegar-cruet-bottle","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eBeautifully designed, this 2 in 1 oil and vinegar cruet bottle gracefully adorns any work surface or dining table and adds a real world of flavour to your Italian themed dining experience. Ideal for storing and serving both oil and vinegar for salads, bread and antipasti, the bottle features two individual pouring spouts with cork stoppers. Dishwasher safe (with cork removed). 12 month guarantee.\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2020-11-05T11:15:53+00:00","created_at":"2018-09-21T17:15:14+01:00","vendor":"Kitchencraft","type":"","tags":["Creative Cook","KITCHENCRAFT","TABLE \u0026 BAR"],"price":1650,"price_min":1650,"price_max":1650,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":9285365989412,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"WFITCRUET100","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Italian Glass Dual Oil \u0026 Vinegar Cruet Bottle (k78s)","public_title":null,"options":["Default Title"],"price":1650,"weight":0,"compare_at_price":null,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250547378","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/oilandvinegarcruetset_0f769927-6636-413c-bf5c-fe8ec42ec79f.jpg?v=1712865947","\/\/\/cdn\/shop\/products\/WFITCRUET100_oil_and_vinegar_cruet_bottles_2.jpg?v=1712865947"],"featured_image":"\/\/\/cdn\/shop\/files\/oilandvinegarcruetset_0f769927-6636-413c-bf5c-fe8ec42ec79f.jpg?v=1712865947","options":["Title"],"media":[{"alt":null,"id":46275582329177,"position":2,"preview_image":{"aspect_ratio":1.0,"height":624,"width":624,"src":"\/\/\/cdn\/shop\/files\/oilandvinegarcruetset_0f769927-6636-413c-bf5c-fe8ec42ec79f.jpg?v=1712865947"},"aspect_ratio":1.0,"height":624,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/oilandvinegarcruetset_0f769927-6636-413c-bf5c-fe8ec42ec79f.jpg?v=1712865947","width":624},{"alt":null,"id":1348189749284,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/WFITCRUET100_oil_and_vinegar_cruet_bottles_2.jpg?v=1712865947"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/WFITCRUET100_oil_and_vinegar_cruet_bottles_2.jpg?v=1712865947","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eBeautifully designed, this 2 in 1 oil and vinegar cruet bottle gracefully adorns any work surface or dining table and adds a real world of flavour to your Italian themed dining experience. Ideal for storing and serving both oil and vinegar for salads, bread and antipasti, the bottle features two individual pouring spouts with cork stoppers. Dishwasher safe (with cork removed). 12 month guarantee.\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
Italian Glass Dual Oil & Vinegar Cruet Bottle (k78s)

Italian Glass Dual Oil & Vinegar Cruet Bottle (k78s)


Beautifully designed, this 2 in 1 oil and vinegar cruet bottle gracefully adorns any work surface or dining table and adds a real world of flavour to your Italian themed dining experience. Ideal for storing and serving both oil and vinegar for salads, bread and antipasti, the bottle features two individual pouring spouts with cork stoppers....

More Info
{"id":6794135535652,"title":"Tala Cocktail Sticks, 50 Piece","handle":"tala-cocktail-sticks-pack-of-50","description":"The Tala Cocktail Sticks are ideal for serving olives cherries sandwiches and canapés for guests. The cocktail sticks are perfect for parties and picnics. They measure approximately 8 cm in size.\u003cbr\u003e\u003cbr\u003e","published_at":"2021-10-28T12:12:50+01:00","created_at":"2021-10-28T12:10:17+01:00","vendor":"George East","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":195,"price_min":195,"price_max":195,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39667460669476,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"10A10507","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Tala Cocktail Sticks, 50 Piece","public_title":null,"options":["Default Title"],"price":195,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5012904105076","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/TALACOCKTAILSTICKS2.jpg?v=1712952369","\/\/\/cdn\/shop\/products\/TalaCocktailSticks.jpg?v=1712952355"],"featured_image":"\/\/\/cdn\/shop\/files\/TALACOCKTAILSTICKS2.jpg?v=1712952369","options":["Title"],"media":[{"alt":null,"id":46288777806169,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/files\/TALACOCKTAILSTICKS2.jpg?v=1712952369"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/TALACOCKTAILSTICKS2.jpg?v=1712952369","width":500},{"alt":null,"id":21085412720676,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/products\/TalaCocktailSticks.jpg?v=1712952355"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/TalaCocktailSticks.jpg?v=1712952355","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"The Tala Cocktail Sticks are ideal for serving olives cherries sandwiches and canapés for guests. The cocktail sticks are perfect for parties and picnics. They measure approximately 8 cm in size.\u003cbr\u003e\u003cbr\u003e"}
Tala Cocktail Sticks, 50 Piece

Tala Cocktail Sticks, 50 Piece


The Tala Cocktail Sticks are ideal for serving olives cherries sandwiches and canapés for guests. The cocktail sticks are perfect for parties and picnics. They measure approximately 8 cm in size.

More Info
Sold out
KitchenCraft Porcelain Salt Pig, White (K15F)
{"id":6617908641828,"title":"KitchenCraft Porcelain Salt Pig, White (K15F)","handle":"kitchencraft-porcelain-salt-pig-white","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eTraditional style white porcelain salt pig, designed to be kept out on the worktop, so salt is kept fresh and ready to hand for use in recipes. Dishwasher safe. \u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2021-05-17T19:25:51+01:00","created_at":"2021-05-17T19:25:13+01:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR"],"price":1395,"price_min":1395,"price_max":1395,"available":false,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39416707350564,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCSPIGCER","requires_shipping":true,"taxable":true,"featured_image":null,"available":false,"name":"KitchenCraft Porcelain Salt Pig, White (K15F)","public_title":null,"options":["Default Title"],"price":1395,"weight":0,"compare_at_price":null,"inventory_quantity":0,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250137715","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/traditionalsaltpig.jpg?v=1712866066"],"featured_image":"\/\/\/cdn\/shop\/files\/traditionalsaltpig.jpg?v=1712866066","options":["Title"],"media":[{"alt":null,"id":46275607658841,"position":2,"preview_image":{"aspect_ratio":1.0,"height":567,"width":567,"src":"\/\/\/cdn\/shop\/files\/traditionalsaltpig.jpg?v=1712866066"},"aspect_ratio":1.0,"height":567,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/traditionalsaltpig.jpg?v=1712866066","width":567}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eTraditional style white porcelain salt pig, designed to be kept out on the worktop, so salt is kept fresh and ready to hand for use in recipes. Dishwasher safe. \u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
KitchenCraft Porcelain Salt Pig, White (K15F)

KitchenCraft Porcelain Salt Pig, White (K15F)


Traditional style white porcelain salt pig, designed to be kept out on the worktop, so salt is kept fresh and ready to hand for use in recipes. Dishwasher safe. 

More Info
Chef Aid Cocktail Sticks, Pack Of 200 (g01z)
{"id":5004958269476,"title":"Chef Aid Cocktail Sticks, Pack Of 200 (g01z)","handle":"chef-aid-cocktail-sticks-pack-of-200","description":"The Chef Aid Cocktail Sticks are ideal for serving olives cherries sandwiches and canapés for guests. Our cocktail sticks are perfect for parties and picnics. They come in a pack of 200.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e","published_at":"2021-06-22T20:41:41+01:00","created_at":"2020-12-10T22:01:32+00:00","vendor":"George East","type":"","tags":["**Offers**","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":120,"price_min":120,"price_max":120,"available":true,"price_varies":false,"compare_at_price":150,"compare_at_price_min":150,"compare_at_price_max":150,"compare_at_price_varies":false,"variants":[{"id":32510701731876,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"10E61120","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Chef Aid Cocktail Sticks, Pack Of 200 (g01z)","public_title":null,"options":["Default Title"],"price":120,"weight":0,"compare_at_price":150,"inventory_quantity":8,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5012904611201","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/cocktailsticks_7f9a0c16-6464-4a88-b6b1-dbf20179c63c.jpg?v=1712952471","\/\/\/cdn\/shop\/products\/10E61120cocktailstick_2.jpg?v=1712952458"],"featured_image":"\/\/\/cdn\/shop\/files\/cocktailsticks_7f9a0c16-6464-4a88-b6b1-dbf20179c63c.jpg?v=1712952471","options":["Title"],"media":[{"alt":null,"id":46288791044441,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/files\/cocktailsticks_7f9a0c16-6464-4a88-b6b1-dbf20179c63c.jpg?v=1712952471"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/cocktailsticks_7f9a0c16-6464-4a88-b6b1-dbf20179c63c.jpg?v=1712952471","width":500},{"alt":null,"id":21173733752868,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/products\/10E61120cocktailstick_2.jpg?v=1712952458"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/10E61120cocktailstick_2.jpg?v=1712952458","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"The Chef Aid Cocktail Sticks are ideal for serving olives cherries sandwiches and canapés for guests. Our cocktail sticks are perfect for parties and picnics. They come in a pack of 200.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e"}
Chef Aid Cocktail Sticks, Pack Of 200 (g01z)

Chef Aid Cocktail Sticks, Pack Of 200 (g01z)


The Chef Aid Cocktail Sticks are ideal for serving olives cherries sandwiches and canapés for guests. Our cocktail sticks are perfect for parties and picnics. They come in a pack of 200.

More Info
{"id":7189865103396,"title":"Star Shaped Bamboo Chopping \u0026 Serving Board","handle":"star-bamboo-chopping-serving-board","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv class=\"product-navigation\" data-mce-fragment=\"1\"\u003e\n\u003cdiv id=\"product-data-panels\" data-mce-fragment=\"1\"\u003e\n\u003cdiv id=\"productinfo\" data-mce-fragment=\"1\"\u003e\n\u003cp data-mce-fragment=\"1\"\u003eA stylish chopping board for the festive season. Perfect for all chopping and cutting tasks in the kitchen and can double up as a cheese or charcuterie board. Eco friendly - made from renewable biodegradable bamboo. Anti bacterial. BPA free. Handwash only and dry immediately. Kraft swing tag with leather tie. \u003cmeta charset=\"utf-8\"\u003e\u003cspan data-mce-fragment=\"1\"\u003eSize at widest: 33cm\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/p\u003e\n\u003cdiv class=\"productdetail\" data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/div\u003e\n\u003cdiv data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv data-mce-fragment=\"1\"\u003e\u003c\/div\u003e\n\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2022-11-11T20:26:22+00:00","created_at":"2022-11-11T20:22:58+00:00","vendor":"Dexam","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":1750,"price_min":1750,"price_max":1750,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40509033152548,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"16050421","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Star Shaped Bamboo Chopping \u0026 Serving Board","public_title":null,"options":["Default Title"],"price":1750,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5017039174904","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/starchoppingboard.jpg?v=1712783523"],"featured_image":"\/\/\/cdn\/shop\/files\/starchoppingboard.jpg?v=1712783523","options":["Title"],"media":[{"alt":null,"id":46264868569433,"position":1,"preview_image":{"aspect_ratio":1.0,"height":737,"width":737,"src":"\/\/\/cdn\/shop\/files\/starchoppingboard.jpg?v=1712783523"},"aspect_ratio":1.0,"height":737,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/starchoppingboard.jpg?v=1712783523","width":737}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003e\n\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv class=\"product-navigation\" data-mce-fragment=\"1\"\u003e\n\u003cdiv id=\"product-data-panels\" data-mce-fragment=\"1\"\u003e\n\u003cdiv id=\"productinfo\" data-mce-fragment=\"1\"\u003e\n\u003cp data-mce-fragment=\"1\"\u003eA stylish chopping board for the festive season. Perfect for all chopping and cutting tasks in the kitchen and can double up as a cheese or charcuterie board. Eco friendly - made from renewable biodegradable bamboo. Anti bacterial. BPA free. Handwash only and dry immediately. Kraft swing tag with leather tie. \u003cmeta charset=\"utf-8\"\u003e\u003cspan data-mce-fragment=\"1\"\u003eSize at widest: 33cm\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/p\u003e\n\u003cdiv class=\"productdetail\" data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/div\u003e\n\u003cdiv data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv data-mce-fragment=\"1\"\u003e\u003c\/div\u003e\n\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Star Shaped Bamboo Chopping & Serving Board

Star Shaped Bamboo Chopping & Serving Board


A stylish chopping board for the festive season. Perfect for all chopping and cutting tasks in the kitchen and can double up as a cheese or charcuterie board. Eco friendly - made from renewable biodegradable bamboo. Anti bacterial. BPA free. Handwash only and dry immediately. Kraft swing tag with leather tie. Size at widest: 33cm

More Info
{"id":6734127824932,"title":"Artesà Rectangular Cheese \u0026 Wine Pairing Slate Platter, 30cm (K406)","handle":"artesa-rectangular-slate-cheese-wine-pairing-platter","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eServe up some style at dinner parties and family feasts with this elegant slate cheese and wine pairing serving board. Make a stylish and informative statement when you’re next hosting a dinner party for friends and family with this elegant slate cheese pairing serving board from the Artesà range. The cheese board is beautifully illustrated with cheese and wine pairings. Measures 30 x 40 cm. Made from natural slate material. Wipe clean only. \u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-09-11T22:46:40+01:00","created_at":"2021-09-11T22:36:46+01:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":1295,"price_min":1295,"price_max":1295,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39578290880548,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTCHSPAIRING","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Rectangular Cheese \u0026 Wine Pairing Slate Platter, 30cm (K406)","public_title":null,"options":["Default Title"],"price":1295,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250794406","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/cheeseandwineslateboard_1.jpg?v=1632328585","\/\/\/cdn\/shop\/products\/cheeseandwineslateboard..jpg?v=1631396763"],"featured_image":"\/\/\/cdn\/shop\/products\/cheeseandwineslateboard_1.jpg?v=1632328585","options":["Title"],"media":[{"alt":null,"id":20916658110500,"position":1,"preview_image":{"aspect_ratio":1.256,"height":507,"width":637,"src":"\/\/\/cdn\/shop\/products\/cheeseandwineslateboard_1.jpg?v=1632328585"},"aspect_ratio":1.256,"height":507,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/cheeseandwineslateboard_1.jpg?v=1632328585","width":637},{"alt":null,"id":20875880726564,"position":2,"preview_image":{"aspect_ratio":1.408,"height":426,"width":600,"src":"\/\/\/cdn\/shop\/products\/cheeseandwineslateboard..jpg?v=1631396763"},"aspect_ratio":1.408,"height":426,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/cheeseandwineslateboard..jpg?v=1631396763","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eServe up some style at dinner parties and family feasts with this elegant slate cheese and wine pairing serving board. Make a stylish and informative statement when you’re next hosting a dinner party for friends and family with this elegant slate cheese pairing serving board from the Artesà range. The cheese board is beautifully illustrated with cheese and wine pairings. Measures 30 x 40 cm. Made from natural slate material. Wipe clean only. \u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Rectangular Cheese & Wine Pairing Slate Platter, 30cm (K406)

Artesà Rectangular Cheese & Wine Pairing Slate Platter, 30cm (K406)


Serve up some style at dinner parties and family feasts with this elegant slate cheese and wine pairing serving board. Make a stylish and informative statement when you’re next hosting a dinner party for friends and family with this elegant slate cheese pairing serving board from the Artesà range. The cheese board is beautifully illustrated wi...

More Info
BarCraft Brandy & Cognac Warmer Gift Set (K281)
{"id":6618080018468,"title":"BarCraft Brandy \u0026 Cognac Warmer Gift Set (K281)","handle":"barcraft-brandy-cognac-warmer-gift-set","description":"Create the perfect moment, relaxing with a warm glass of brandy. The only gift any brandy lover needs includes a snifter brandy glass, chrome stand and glass tealight holder. Pour a generous measure of your favourite brandy and place in the stand allowing the candle flame to gently warm your brandy to the perfect temperature. Then sit back and enjoy. 350ml capacity snifter glass.  Chrome warming stand.  Glass tealight holder. Candle not included. Glass is handwash only. Stand and tealight holder are wipe clean only","published_at":"2021-05-17T22:18:31+01:00","created_at":"2021-05-17T22:17:17+01:00","vendor":"Kitchencraft","type":"","tags":["**Offers**","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":1640,"price_min":1640,"price_max":1640,"available":true,"price_varies":false,"compare_at_price":2050,"compare_at_price_min":2050,"compare_at_price_max":2050,"compare_at_price_varies":false,"variants":[{"id":39416994725924,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCBWARMER","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Brandy \u0026 Cognac Warmer Gift Set (K281)","public_title":null,"options":["Default Title"],"price":1640,"weight":0,"compare_at_price":2050,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250849281","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/BCBWARMERbrandycognacwarmer.jpg?v=1621286305","\/\/\/cdn\/shop\/products\/BCBWARMER_10brandycognacwarmer.jpg?v=1621286305","\/\/\/cdn\/shop\/products\/BCBWARMER_22brandycognacwarmer.jpg?v=1621286305"],"featured_image":"\/\/\/cdn\/shop\/products\/BCBWARMERbrandycognacwarmer.jpg?v=1621286305","options":["Title"],"media":[{"alt":null,"id":20482144895012,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/BCBWARMERbrandycognacwarmer.jpg?v=1621286305"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/BCBWARMERbrandycognacwarmer.jpg?v=1621286305","width":500},{"alt":null,"id":20482144927780,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/BCBWARMER_10brandycognacwarmer.jpg?v=1621286305"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/BCBWARMER_10brandycognacwarmer.jpg?v=1621286305","width":500},{"alt":null,"id":20482144960548,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/BCBWARMER_22brandycognacwarmer.jpg?v=1621286305"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/BCBWARMER_22brandycognacwarmer.jpg?v=1621286305","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Create the perfect moment, relaxing with a warm glass of brandy. The only gift any brandy lover needs includes a snifter brandy glass, chrome stand and glass tealight holder. Pour a generous measure of your favourite brandy and place in the stand allowing the candle flame to gently warm your brandy to the perfect temperature. Then sit back and enjoy. 350ml capacity snifter glass.  Chrome warming stand.  Glass tealight holder. Candle not included. Glass is handwash only. Stand and tealight holder are wipe clean only"}
BarCraft Brandy & Cognac Warmer Gift Set (K281)

BarCraft Brandy & Cognac Warmer Gift Set (K281)


Create the perfect moment, relaxing with a warm glass of brandy. The only gift any brandy lover needs includes a snifter brandy glass, chrome stand and glass tealight holder. Pour a generous measure of your favourite brandy and place in the stand allowing the candle flame to gently warm your brandy to the perfect temperature. Then sit back and e...

More Info
{"id":6618076971044,"title":"BarCraft Champagne \u0026 Prosecco Opener (K720)","handle":"barcraft-champagne-prosecco-opener","description":"Stainless steel opener slides easily over corks creating a secure hold when opening sparkling wines. By holding the cork firmly you are able to twist the bottle to slowly release the cork without wasting a drop. Solid stainless steel construction.  Dishwasher safe","published_at":"2021-05-17T22:16:37+01:00","created_at":"2021-05-17T22:14:58+01:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":750,"price_min":750,"price_max":750,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39416992071716,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCCHAMOP","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Champagne \u0026 Prosecco Opener (K720)","public_title":null,"options":["Default Title"],"price":750,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250818720","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/champagleproseccoopener_c286eb2f-33b1-4f68-a7e0-54491fd9c569.jpg?v=1712953569","\/\/\/cdn\/shop\/products\/BCCHAMOP_20champagneproseccoopener.jpg?v=1712953554"],"featured_image":"\/\/\/cdn\/shop\/files\/champagleproseccoopener_c286eb2f-33b1-4f68-a7e0-54491fd9c569.jpg?v=1712953569","options":["Title"],"media":[{"alt":null,"id":46288973070681,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/files\/champagleproseccoopener_c286eb2f-33b1-4f68-a7e0-54491fd9c569.jpg?v=1712953569"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/champagleproseccoopener_c286eb2f-33b1-4f68-a7e0-54491fd9c569.jpg?v=1712953569","width":500},{"alt":null,"id":20482137096228,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/BCCHAMOP_20champagneproseccoopener.jpg?v=1712953554"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/BCCHAMOP_20champagneproseccoopener.jpg?v=1712953554","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Stainless steel opener slides easily over corks creating a secure hold when opening sparkling wines. By holding the cork firmly you are able to twist the bottle to slowly release the cork without wasting a drop. Solid stainless steel construction.  Dishwasher safe"}
BarCraft Champagne & Prosecco Opener (K720)

BarCraft Champagne & Prosecco Opener (K720)


Stainless steel opener slides easily over corks creating a secure hold when opening sparkling wines. By holding the cork firmly you are able to twist the bottle to slowly release the cork without wasting a drop. Solid stainless steel construction.  Dishwasher safe

More Info
{"id":1599948750884,"title":"MasterClass Electric Dual Salt \u0026 Pepper Mill (K44G)","handle":"masterclass-electric-dual-salt-pepper-mill","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003ePerfect for everyday and tabletop use, this soft touch two in one electronic mill features transparent chambers and adjustable grind levels from coarse to fine. With two highly durable precision ceramic grinding mechanisms for long last performance! Cook with confidence using kitchen tools and equipment that are perfect for the aspiring chef. Wipe clean only. Requires 6 x AAA batteries (not included). 5 year guarantee\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2020-12-11T12:34:17+00:00","created_at":"2019-09-10T21:45:00+01:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR"],"price":2395,"price_min":2395,"price_max":2395,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":12291109290020,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"MCSNPEMILL","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"MasterClass Electric Dual Salt \u0026 Pepper Mill (K44G)","public_title":null,"options":["Default Title"],"price":2395,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250594044","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/salt_and_pepper_mill.jpg?v=1712787094","\/\/\/cdn\/shop\/products\/MCSNPEMILL_salt_and_pepper_mill_2.jpg?v=1712787094"],"featured_image":"\/\/\/cdn\/shop\/files\/salt_and_pepper_mill.jpg?v=1712787094","options":["Title"],"media":[{"alt":null,"id":46265679937881,"position":2,"preview_image":{"aspect_ratio":1.0,"height":652,"width":652,"src":"\/\/\/cdn\/shop\/files\/salt_and_pepper_mill.jpg?v=1712787094"},"aspect_ratio":1.0,"height":652,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/salt_and_pepper_mill.jpg?v=1712787094","width":652},{"alt":null,"id":2746711670820,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/MCSNPEMILL_salt_and_pepper_mill_2.jpg?v=1712787094"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/MCSNPEMILL_salt_and_pepper_mill_2.jpg?v=1712787094","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003ePerfect for everyday and tabletop use, this soft touch two in one electronic mill features transparent chambers and adjustable grind levels from coarse to fine. With two highly durable precision ceramic grinding mechanisms for long last performance! Cook with confidence using kitchen tools and equipment that are perfect for the aspiring chef. Wipe clean only. Requires 6 x AAA batteries (not included). 5 year guarantee\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
MasterClass Electric Dual Salt & Pepper Mill (K44G)

MasterClass Electric Dual Salt & Pepper Mill (K44G)


Perfect for everyday and tabletop use, this soft touch two in one electronic mill features transparent chambers and adjustable grind levels from coarse to fine. With two highly durable precision ceramic grinding mechanisms for long last performance! Cook with confidence using kitchen tools and equipment that are perfect for the aspiring chef. ...

More Info
{"id":6845372563492,"title":"Artesà Appetiser Acacia Wood Serving \u0026 Baguette Board, 48cm","handle":"artesa-appetiser-acacia-wood-serving-baguette-board","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eIncreasingly the way to serve cold meats, pickles, antipasti and of course a selection of bread, this natural acacia wood board features heavy grain and a decorative motif for added style. We recommend hand washing. Size: 48cm x 13cm (19\" x 5\")\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-12-13T21:42:55+00:00","created_at":"2021-12-01T21:27:45+00:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":1795,"price_min":1795,"price_max":1795,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39773818454052,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTBBOARD","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Appetiser Acacia Wood Serving \u0026 Baguette Board, 48cm","public_title":null,"options":["Default Title"],"price":1795,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250472564","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/woodenservingplankboard.jpg?v=1638394340","\/\/\/cdn\/shop\/products\/woodenservingplankboard_069e627e-ba81-4d35-9bd7-19de09be52f6.jpg?v=1638394340"],"featured_image":"\/\/\/cdn\/shop\/products\/woodenservingplankboard.jpg?v=1638394340","options":["Title"],"media":[{"alt":null,"id":21295259156516,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/\/cdn\/shop\/products\/woodenservingplankboard.jpg?v=1638394340"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/woodenservingplankboard.jpg?v=1638394340","width":700},{"alt":null,"id":21295255715876,"position":2,"preview_image":{"aspect_ratio":1.0,"height":690,"width":690,"src":"\/\/\/cdn\/shop\/products\/woodenservingplankboard_069e627e-ba81-4d35-9bd7-19de09be52f6.jpg?v=1638394340"},"aspect_ratio":1.0,"height":690,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/woodenservingplankboard_069e627e-ba81-4d35-9bd7-19de09be52f6.jpg?v=1638394340","width":690}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eIncreasingly the way to serve cold meats, pickles, antipasti and of course a selection of bread, this natural acacia wood board features heavy grain and a decorative motif for added style. We recommend hand washing. Size: 48cm x 13cm (19\" x 5\")\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Appetiser Acacia Wood Serving & Baguette Board, 48cm

Artesà Appetiser Acacia Wood Serving & Baguette Board, 48cm


Increasingly the way to serve cold meats, pickles, antipasti and of course a selection of bread, this natural acacia wood board features heavy grain and a decorative motif for added style. We recommend hand washing. Size: 48cm x 13cm (19" x 5")

More Info
{"id":6842855587876,"title":"Polished Stainless Steel Hip Flask, 170ml","handle":"kitchencraft-polished-stainless-steel-hip-flask","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eTake your favourite tipple with you wherever you go, holding 170ml of your desired drink for any event. A classic and elegant gift, this polished hip flask is intended to impress. Dishwasher safe. \u003cmeta charset=\"utf-8\"\u003e \u003cspan data-mce-fragment=\"1\"\u003eCapacity: 170ml. \u003c\/span\u003e\u003cspan data-mce-fragment=\"1\"\u003eBoxed\u003c\/span\u003e\n\u003cdiv class=\"table-specs-wrap\" data-mce-fragment=\"1\"\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2021-12-13T20:33:27+00:00","created_at":"2021-11-30T23:28:09+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":1350,"price_min":1350,"price_max":1350,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39769267306532,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCHIP","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Polished Stainless Steel Hip Flask, 170ml","public_title":null,"options":["Default Title"],"price":1350,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250517258","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/stainlesssteelhipflask._1.jpg?v=1712953959","\/\/\/cdn\/shop\/products\/stainlesssteelhipflask._1.jpg?v=1712953941"],"featured_image":"\/\/\/cdn\/shop\/files\/stainlesssteelhipflask._1.jpg?v=1712953959","options":["Title"],"media":[{"alt":null,"id":46289032479065,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/files\/stainlesssteelhipflask._1.jpg?v=1712953959"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/stainlesssteelhipflask._1.jpg?v=1712953959","width":600},{"alt":null,"id":21290143383588,"position":3,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/products\/stainlesssteelhipflask._1.jpg?v=1712953941"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/stainlesssteelhipflask._1.jpg?v=1712953941","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eTake your favourite tipple with you wherever you go, holding 170ml of your desired drink for any event. A classic and elegant gift, this polished hip flask is intended to impress. Dishwasher safe. \u003cmeta charset=\"utf-8\"\u003e \u003cspan data-mce-fragment=\"1\"\u003eCapacity: 170ml. \u003c\/span\u003e\u003cspan data-mce-fragment=\"1\"\u003eBoxed\u003c\/span\u003e\n\u003cdiv class=\"table-specs-wrap\" data-mce-fragment=\"1\"\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
Polished Stainless Steel Hip Flask, 170ml

Polished Stainless Steel Hip Flask, 170ml


Take your favourite tipple with you wherever you go, holding 170ml of your desired drink for any event. A classic and elegant gift, this polished hip flask is intended to impress. Dishwasher safe.  Capacity: 170ml. Boxed

More Info
{"id":6835543539748,"title":"Acrylic Champagne \u0026 Wine Cooler Pail (ed02)","handle":"acrylic-champagne-bucket-wine-cooler","description":"\u003cp\u003eA useful acrylic drinks pail to chill wine, water and champagne bottles. With a stylish angled shape with integrated handles, the pail is ideal for dinner parties and small get togethers. Size:  23 x 23 x 18cm\u003c\/p\u003e","published_at":"2021-11-26T23:14:14+00:00","created_at":"2021-11-26T22:51:06+00:00","vendor":"Eddingtons","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":1695,"price_min":1695,"price_max":1695,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39755237687332,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"39F1257","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Acrylic Champagne \u0026 Wine Cooler Pail (ed02)","public_title":null,"options":["Default Title"],"price":1695,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"4710900632602","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/acrylicchampagneandwinedrinkspail_1.jpg?v=1638283851"],"featured_image":"\/\/\/cdn\/shop\/products\/acrylicchampagneandwinedrinkspail_1.jpg?v=1638283851","options":["Title"],"media":[{"alt":null,"id":21287626211364,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/\/cdn\/shop\/products\/acrylicchampagneandwinedrinkspail_1.jpg?v=1638283851"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/acrylicchampagneandwinedrinkspail_1.jpg?v=1638283851","width":700}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eA useful acrylic drinks pail to chill wine, water and champagne bottles. With a stylish angled shape with integrated handles, the pail is ideal for dinner parties and small get togethers. Size:  23 x 23 x 18cm\u003c\/p\u003e"}
Acrylic Champagne & Wine Cooler Pail (ed02)

Acrylic Champagne & Wine Cooler Pail (ed02)


A useful acrylic drinks pail to chill wine, water and champagne bottles. With a stylish angled shape with integrated handles, the pail is ideal for dinner parties and small get togethers. Size:  23 x 23 x 18cm

More Info
Tala Wine Preserver With Stopper
{"id":6793122119716,"title":"Tala Wine Preserver With Stopper","handle":"tala-wine-saver-and-stopper","description":"This wine saver removes the air preventing oxygenation and preserving your wine for longer. The wine saver has a soft grip for comfort and ease of use. Handwashing is recommended to keep your item in top condition.  Not suitable for use with sparkling wines\u003cbr\u003e","published_at":"2021-10-27T17:26:42+01:00","created_at":"2021-10-27T17:16:05+01:00","vendor":"George East","type":"","tags":["**Offers**","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":600,"price_min":600,"price_max":600,"available":true,"price_varies":false,"compare_at_price":750,"compare_at_price_min":750,"compare_at_price_max":750,"compare_at_price_varies":false,"variants":[{"id":39665423188004,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"10A99950","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Tala Wine Preserver With Stopper","public_title":null,"options":["Default Title"],"price":600,"weight":0,"compare_at_price":750,"inventory_quantity":5,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5012904000449","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/winesaverpreserverandstopper.jpg?v=1668697391","\/\/\/cdn\/shop\/products\/winepreserversaverandstopper.jpg?v=1668697418","\/\/\/cdn\/shop\/products\/TalaWineSaverwith1Stoppers.jpg?v=1668697183"],"featured_image":"\/\/\/cdn\/shop\/products\/winesaverpreserverandstopper.jpg?v=1668697391","options":["Title"],"media":[{"alt":null,"id":23181853655076,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/products\/winesaverpreserverandstopper.jpg?v=1668697391"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/winesaverpreserverandstopper.jpg?v=1668697391","width":600},{"alt":null,"id":23181853687844,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/products\/winepreserversaverandstopper.jpg?v=1668697418"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/winepreserversaverandstopper.jpg?v=1668697418","width":600},{"alt":null,"id":21080847613988,"position":3,"preview_image":{"aspect_ratio":1.0,"height":1024,"width":1024,"src":"\/\/\/cdn\/shop\/products\/TalaWineSaverwith1Stoppers.jpg?v=1668697183"},"aspect_ratio":1.0,"height":1024,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/TalaWineSaverwith1Stoppers.jpg?v=1668697183","width":1024}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"This wine saver removes the air preventing oxygenation and preserving your wine for longer. The wine saver has a soft grip for comfort and ease of use. Handwashing is recommended to keep your item in top condition.  Not suitable for use with sparkling wines\u003cbr\u003e"}
Tala Wine Preserver With Stopper

Tala Wine Preserver With Stopper


This wine saver removes the air preventing oxygenation and preserving your wine for longer. The wine saver has a soft grip for comfort and ease of use. Handwashing is recommended to keep your item in top condition.  Not suitable for use with sparkling wines

More Info
{"id":386099806244,"title":"Natural Elements Round Wooden Serving Board, 30cm (k80m)","handle":"natural-elements-acacia-wood-round-serving-paddle","description":"Made with responsibly sourced acacia wood, perfect for serving in style. Ideal for serving a selection of bread, cheese, antipasti and tapas this striking serving board will become a key piece when entertaining. The round paddle shape is both practical to hold and simple enough to let the natural beauty of the acacia wood shine. This large size board guarantees maximum serving impact! Made with wood from responsible source. Size: 41cm x 30cm. Handwash only. \u003cstrong\u003e\u003cem\u003e\u003cspan style=\"color: #ff2a00;\"\u003ePlease note that every wooden serving board is slightly different.\u003c\/span\u003e\u003c\/em\u003e\u003c\/strong\u003e\u003cbr\u003e","published_at":"2021-05-11T14:01:02+01:00","created_at":"2017-11-23T09:37:43+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW"],"price":2795,"price_min":2795,"price_max":2795,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4992289701924,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"NECHOPRD","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Natural Elements Round Wooden Serving Board, 30cm (k80m)","public_title":null,"options":["Default Title"],"price":2795,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250488800","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/NECHOPRDCHOPPINGSERVINGBOARD.jpg?v=1632327816","\/\/\/cdn\/shop\/products\/roundservingchoppingboard_1.jpg?v=1637083426","\/\/\/cdn\/shop\/products\/woodservingandchoppingboard_1_1.jpg?v=1637083390"],"featured_image":"\/\/\/cdn\/shop\/products\/NECHOPRDCHOPPINGSERVINGBOARD.jpg?v=1632327816","options":["Title"],"media":[{"alt":null,"id":20455979450404,"position":1,"preview_image":{"aspect_ratio":1.371,"height":321,"width":440,"src":"\/\/\/cdn\/shop\/products\/NECHOPRDCHOPPINGSERVINGBOARD.jpg?v=1632327816"},"aspect_ratio":1.371,"height":321,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/NECHOPRDCHOPPINGSERVINGBOARD.jpg?v=1632327816","width":440},{"alt":null,"id":21199002173476,"position":2,"preview_image":{"aspect_ratio":1.285,"height":449,"width":577,"src":"\/\/\/cdn\/shop\/products\/roundservingchoppingboard_1.jpg?v=1637083426"},"aspect_ratio":1.285,"height":449,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/roundservingchoppingboard_1.jpg?v=1637083426","width":577},{"alt":null,"id":21199070199844,"position":3,"preview_image":{"aspect_ratio":1.258,"height":477,"width":600,"src":"\/\/\/cdn\/shop\/products\/woodservingandchoppingboard_1_1.jpg?v=1637083390"},"aspect_ratio":1.258,"height":477,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/woodservingandchoppingboard_1_1.jpg?v=1637083390","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Made with responsibly sourced acacia wood, perfect for serving in style. Ideal for serving a selection of bread, cheese, antipasti and tapas this striking serving board will become a key piece when entertaining. The round paddle shape is both practical to hold and simple enough to let the natural beauty of the acacia wood shine. This large size board guarantees maximum serving impact! Made with wood from responsible source. Size: 41cm x 30cm. Handwash only. \u003cstrong\u003e\u003cem\u003e\u003cspan style=\"color: #ff2a00;\"\u003ePlease note that every wooden serving board is slightly different.\u003c\/span\u003e\u003c\/em\u003e\u003c\/strong\u003e\u003cbr\u003e"}
Natural Elements Round Wooden Serving Board, 30cm (k80m)

Natural Elements Round Wooden Serving Board, 30cm (k80m)


Made with responsibly sourced acacia wood, perfect for serving in style. Ideal for serving a selection of bread, cheese, antipasti and tapas this striking serving board will become a key piece when entertaining. The round paddle shape is both practical to hold and simple enough to let the natural beauty of the acacia wood shine. This large size ...

More Info
{"id":4454987431972,"title":"Rabbit Zippity Wine Tool Kit (k57m)","handle":"metrokane-rabbit-zippity-wine-tool-kit","description":"The most reasonable wine tool kit on the market. It includes everything you need to open, serve and seal your wine. Packaged in a clear lucite case, this kit includes the Zippity 2-step, the fastest 2-step waiter’s corkscrew ever made, the wine\/champagne sealer and pourer with stopper. Includes the fastest 2-step waiter’s corkscrew ever made with a retractable foil cutter and non-stick coated spiral. Includes the pourer\/stopper which pours drip-free and has an easy-grip velvet finish. Includes the wine\/champagne sealer which seals wine air-tight, preserves champagne bubbles and keeps fizz in soda bottles.","published_at":"2021-02-17T00:06:00+00:00","created_at":"2020-01-08T21:45:39+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":3195,"price_min":3195,"price_max":3195,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":31545651855396,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCW5657N","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Rabbit Zippity Wine Tool Kit (k57m)","public_title":null,"options":["Default Title"],"price":3195,"weight":0,"compare_at_price":null,"inventory_quantity":4,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250836861","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/rabbit_zippity_wine_tool_kit_2.jpg?v=1578520128","\/\/\/cdn\/shop\/products\/rabbit_zippity_wine_tool_kit.jpg?v=1578520128"],"featured_image":"\/\/\/cdn\/shop\/products\/rabbit_zippity_wine_tool_kit_2.jpg?v=1578520128","options":["Title"],"media":[{"alt":null,"id":6100834582564,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/rabbit_zippity_wine_tool_kit_2.jpg?v=1578520128"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/rabbit_zippity_wine_tool_kit_2.jpg?v=1578520128","width":500},{"alt":null,"id":6100834615332,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/rabbit_zippity_wine_tool_kit.jpg?v=1578520128"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/rabbit_zippity_wine_tool_kit.jpg?v=1578520128","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"The most reasonable wine tool kit on the market. It includes everything you need to open, serve and seal your wine. Packaged in a clear lucite case, this kit includes the Zippity 2-step, the fastest 2-step waiter’s corkscrew ever made, the wine\/champagne sealer and pourer with stopper. Includes the fastest 2-step waiter’s corkscrew ever made with a retractable foil cutter and non-stick coated spiral. Includes the pourer\/stopper which pours drip-free and has an easy-grip velvet finish. Includes the wine\/champagne sealer which seals wine air-tight, preserves champagne bubbles and keeps fizz in soda bottles."}
Rabbit Zippity Wine Tool Kit (k57m)

Rabbit Zippity Wine Tool Kit (k57m)


The most reasonable wine tool kit on the market. It includes everything you need to open, serve and seal your wine. Packaged in a clear lucite case, this kit includes the Zippity 2-step, the fastest 2-step waiter’s corkscrew ever made, the wine/champagne sealer and pourer with stopper. Includes the fastest 2-step waiter’s corkscrew ever made wit...

More Info
{"id":7213062783012,"title":"BarCraft Wine \u0026 Champagne Sealer","handle":"barcraft-wine-champagne-sealer","description":"This airtight Wine and Champagne Sealer from BarCraft preserves bubbles and keeps drinks fresher for longer. Simply place the device onto an open bottle, press down to secure it and turn the knob clockwise until the seal is tight to create a vacuum-seal. The champagne sealer fits most standard-sized wine and champagne bottles and allows for horizontal storage. Measurements: 4.5cm x 6cm\u0026amp;nbsp;","published_at":"2022-12-13T20:19:15+00:00","created_at":"2022-12-13T20:16:15+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":950,"price_min":950,"price_max":950,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40545843871780,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCCHAMSEAL","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Wine \u0026 Champagne Sealer","public_title":null,"options":["Default Title"],"price":950,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5057982087180","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/winechampagnesealer.webp?v=1670962741","\/\/\/cdn\/shop\/products\/winechampagnesealer.jpg?v=1670962741","\/\/\/cdn\/shop\/products\/winechampagnesealer_c89bbe20-4fcb-48af-905b-092d9707e147.jpg?v=1670962739"],"featured_image":"\/\/\/cdn\/shop\/products\/winechampagnesealer.webp?v=1670962741","options":["Title"],"media":[{"alt":null,"id":23294988386340,"position":1,"preview_image":{"aspect_ratio":1.0,"height":640,"width":640,"src":"\/\/\/cdn\/shop\/products\/winechampagnesealer.webp?v=1670962741"},"aspect_ratio":1.0,"height":640,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/winechampagnesealer.webp?v=1670962741","width":640},{"alt":null,"id":23294988353572,"position":2,"preview_image":{"aspect_ratio":1.0,"height":640,"width":640,"src":"\/\/\/cdn\/shop\/products\/winechampagnesealer.jpg?v=1670962741"},"aspect_ratio":1.0,"height":640,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/winechampagnesealer.jpg?v=1670962741","width":640},{"alt":null,"id":23294988419108,"position":3,"preview_image":{"aspect_ratio":1.499,"height":427,"width":640,"src":"\/\/\/cdn\/shop\/products\/winechampagnesealer_c89bbe20-4fcb-48af-905b-092d9707e147.jpg?v=1670962739"},"aspect_ratio":1.499,"height":427,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/winechampagnesealer_c89bbe20-4fcb-48af-905b-092d9707e147.jpg?v=1670962739","width":640}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"This airtight Wine and Champagne Sealer from BarCraft preserves bubbles and keeps drinks fresher for longer. Simply place the device onto an open bottle, press down to secure it and turn the knob clockwise until the seal is tight to create a vacuum-seal. The champagne sealer fits most standard-sized wine and champagne bottles and allows for horizontal storage. Measurements: 4.5cm x 6cm\u0026amp;nbsp;"}
BarCraft Wine & Champagne Sealer

BarCraft Wine & Champagne Sealer


This airtight Wine and Champagne Sealer from BarCraft preserves bubbles and keeps drinks fresher for longer. Simply place the device onto an open bottle, press down to secure it and turn the knob clockwise until the seal is tight to create a vacuum-seal. The champagne sealer fits most standard-sized wine and champagne bottles and allows for hori...

More Info
Creative Tops Oval Acacia Wood Serving Board, 37cm
{"id":6845374791716,"title":"Creative Tops Oval Acacia Wood Serving Board, 37cm","handle":"creative-tops-oval-acacia-wood-serving-board","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eBring the simplicity of nature to dining with this wooden board from the Naturals collection. Beautifully understated, this board is crafted in natural acacia wood with a luxurious steel handle finished in gold. This serving board is an attractive way to serve nibbles, breads, charcuterie or cheese and also features non-slip feet for secure serving. Embracing a mix of materials with naturally occurring patterns and the modest imperfections of nature, Naturals adds a fresh breath of organic style to the home. Size: 37cm x 22cm approx.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-12-13T21:42:07+00:00","created_at":"2021-12-01T21:33:51+00:00","vendor":"Kitchencraft","type":"","tags":["**Offers**","cheese boards","gifts for him","KITCHENCRAFT"],"price":1160,"price_min":1160,"price_max":1160,"available":true,"price_varies":false,"compare_at_price":1450,"compare_at_price_min":1450,"compare_at_price_max":1450,"compare_at_price_varies":false,"variants":[{"id":39773824843812,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"5235041","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Creative Tops Oval Acacia Wood Serving Board, 37cm","public_title":null,"options":["Default Title"],"price":1160,"weight":0,"compare_at_price":1450,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5050993329232","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/ovalservingboard_aa8399ab-e68a-4507-a327-76afbe74710c.jpg?v=1640123590","\/\/\/cdn\/shop\/products\/ovalservingboard.jpg?v=1638394644"],"featured_image":"\/\/\/cdn\/shop\/products\/ovalservingboard_aa8399ab-e68a-4507-a327-76afbe74710c.jpg?v=1640123590","options":["Title"],"media":[{"alt":null,"id":21295280357412,"position":1,"preview_image":{"aspect_ratio":1.411,"height":487,"width":687,"src":"\/\/\/cdn\/shop\/products\/ovalservingboard_aa8399ab-e68a-4507-a327-76afbe74710c.jpg?v=1640123590"},"aspect_ratio":1.411,"height":487,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/ovalservingboard_aa8399ab-e68a-4507-a327-76afbe74710c.jpg?v=1640123590","width":687},{"alt":null,"id":21295275409444,"position":2,"preview_image":{"aspect_ratio":1.333,"height":450,"width":600,"src":"\/\/\/cdn\/shop\/products\/ovalservingboard.jpg?v=1638394644"},"aspect_ratio":1.333,"height":450,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/ovalservingboard.jpg?v=1638394644","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eBring the simplicity of nature to dining with this wooden board from the Naturals collection. Beautifully understated, this board is crafted in natural acacia wood with a luxurious steel handle finished in gold. This serving board is an attractive way to serve nibbles, breads, charcuterie or cheese and also features non-slip feet for secure serving. Embracing a mix of materials with naturally occurring patterns and the modest imperfections of nature, Naturals adds a fresh breath of organic style to the home. Size: 37cm x 22cm approx.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Creative Tops Oval Acacia Wood Serving Board, 37cm

Creative Tops Oval Acacia Wood Serving Board, 37cm


Bring the simplicity of nature to dining with this wooden board from the Naturals collection. Beautifully understated, this board is crafted in natural acacia wood with a luxurious steel handle finished in gold. This serving board is an attractive way to serve nibbles, breads, charcuterie or cheese and also features non-slip feet for secure se...

More Info
{"id":6845368303652,"title":"Reversible Wood Serving \u0026 Preparing Board, 40cm","handle":"industrial-kitchen-reversible-mango-wood-board-for-serving-preparing","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eCombining repurposed natural resources with distressed-effect metal, the Industrial Kitchen single-handle serving board is the epitome of refined elegance and rugged industrial charm. Whether it’s propped up on display on a countertop, or laden with delicious snacks and nibbles for a party, it’s sure to capture the attention of guests and visitors every time you show it off. The platter board is made from pieces of solid mango wood; which, in addition to looking truly stunning when piled high with food, is also extremely hard-wearing, so is ideal for use as a cheese board, or sharing platter where knives are used. With both side at your disposal, you can easily segregate ingredients when catering for different dietary requirements. Uniquely beautiful and refreshingly practical to boot, the board makes a handsome addition to any serving collection, and a fine gift for those following the modern industrial trend. Dimensions (includes handles): 40 cm x 15 cm \/ 15½” x 6”.  Always wash wood by hand- do not soak.  Fantastically multipurpose - it's both a prep board and a serving tray. Comes with a 12 month guarantee\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-12-13T21:45:59+00:00","created_at":"2021-12-01T21:18:32+00:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":2295,"price_min":2295,"price_max":2295,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39773803053092,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"INDSBOARDREC","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Reversible Wood Serving \u0026 Preparing Board, 40cm","public_title":null,"options":["Default Title"],"price":2295,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250793317","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/woodenservingboardplatter.jpg?v=1638393756"],"featured_image":"\/\/\/cdn\/shop\/products\/woodenservingboardplatter.jpg?v=1638393756","options":["Title"],"media":[{"alt":null,"id":21295225700388,"position":1,"preview_image":{"aspect_ratio":1.257,"height":557,"width":700,"src":"\/\/\/cdn\/shop\/products\/woodenservingboardplatter.jpg?v=1638393756"},"aspect_ratio":1.257,"height":557,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/woodenservingboardplatter.jpg?v=1638393756","width":700}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eCombining repurposed natural resources with distressed-effect metal, the Industrial Kitchen single-handle serving board is the epitome of refined elegance and rugged industrial charm. Whether it’s propped up on display on a countertop, or laden with delicious snacks and nibbles for a party, it’s sure to capture the attention of guests and visitors every time you show it off. The platter board is made from pieces of solid mango wood; which, in addition to looking truly stunning when piled high with food, is also extremely hard-wearing, so is ideal for use as a cheese board, or sharing platter where knives are used. With both side at your disposal, you can easily segregate ingredients when catering for different dietary requirements. Uniquely beautiful and refreshingly practical to boot, the board makes a handsome addition to any serving collection, and a fine gift for those following the modern industrial trend. Dimensions (includes handles): 40 cm x 15 cm \/ 15½” x 6”.  Always wash wood by hand- do not soak.  Fantastically multipurpose - it's both a prep board and a serving tray. Comes with a 12 month guarantee\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Reversible Wood Serving & Preparing Board, 40cm

Reversible Wood Serving & Preparing Board, 40cm


Combining repurposed natural resources with distressed-effect metal, the Industrial Kitchen single-handle serving board is the epitome of refined elegance and rugged industrial charm. Whether it’s propped up on display on a countertop, or laden with delicious snacks and nibbles for a party, it’s sure to capture the attention of guests and visi...

More Info
Deep Wooden Chopping Board, 38cm x 30cm (ed21)
{"id":6807152754724,"title":"Deep Wooden Chopping Board, 38cm x 30cm (ed21)","handle":"copy-of-professional-wooden-chopping-board-50cm-x-35cm","description":"\u003cp\u003eThis durable wooden chopping board is ideal for slicing and chopping meat and vegetables.  Complete with end finger grooves, it allows for easy handling. Handwash only. Size: 38cm x 30.5cm x 4cm. Made with FSC certified beechwood supplied from sustainable sources in central Europe. \u003cbr\u003e\u003c\/p\u003e","published_at":"2021-11-09T09:57:37+00:00","created_at":"2021-11-09T09:55:14+00:00","vendor":"Eddingtons","type":"","tags":["**Offers**","KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW"],"price":2956,"price_min":2956,"price_max":2956,"available":true,"price_varies":false,"compare_at_price":3695,"compare_at_price_min":3695,"compare_at_price_max":3695,"compare_at_price_varies":false,"variants":[{"id":39693699383332,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"433830","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Deep Wooden Chopping Board, 38cm x 30cm (ed21)","public_title":null,"options":["Default Title"],"price":2956,"weight":0,"compare_at_price":3695,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060021830500","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/largechoppingboard_0fbee5be-3bda-480c-ae81-37defbdbb80d.jpg?v=1712783772"],"featured_image":"\/\/\/cdn\/shop\/files\/largechoppingboard_0fbee5be-3bda-480c-ae81-37defbdbb80d.jpg?v=1712783772","options":["Title"],"media":[{"alt":null,"id":46264918016345,"position":1,"preview_image":{"aspect_ratio":1.0,"height":737,"width":737,"src":"\/\/\/cdn\/shop\/files\/largechoppingboard_0fbee5be-3bda-480c-ae81-37defbdbb80d.jpg?v=1712783772"},"aspect_ratio":1.0,"height":737,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/largechoppingboard_0fbee5be-3bda-480c-ae81-37defbdbb80d.jpg?v=1712783772","width":737}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eThis durable wooden chopping board is ideal for slicing and chopping meat and vegetables.  Complete with end finger grooves, it allows for easy handling. Handwash only. Size: 38cm x 30.5cm x 4cm. Made with FSC certified beechwood supplied from sustainable sources in central Europe. \u003cbr\u003e\u003c\/p\u003e"}
Deep Wooden Chopping Board, 38cm x 30cm (ed21)

Deep Wooden Chopping Board, 38cm x 30cm (ed21)


This durable wooden chopping board is ideal for slicing and chopping meat and vegetables.  Complete with end finger grooves, it allows for easy handling. Handwash only. Size: 38cm x 30.5cm x 4cm. Made with FSC certified beechwood supplied from sustainable sources in central Europe. 

More Info
Deep Wooden Chopping Board, 50cm x 35cm (ed51)
{"id":6806563389476,"title":"Deep Wooden Chopping Board, 50cm x 35cm (ed51)","handle":"professional-wooden-chopping-board-50cm-x-35cm","description":"\u003cp\u003eThis durable wooden chopping board is ideal for slicing and chopping meat and vegetables.  Complete with end finger grooves, it allows for easy handling. Handwash only. Size: 50cm x 35cm x 4cm. Made with FSC certified beechwood supplied from sustainable sources in central Europe. \u003cbr\u003e\u003c\/p\u003e","published_at":"2021-11-08T22:54:12+00:00","created_at":"2021-11-08T22:52:33+00:00","vendor":"Eddingtons","type":"","tags":["**Offers**","KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW"],"price":4156,"price_min":4156,"price_max":4156,"available":true,"price_varies":false,"compare_at_price":5195,"compare_at_price_min":5195,"compare_at_price_max":5195,"compare_at_price_varies":false,"variants":[{"id":39692626788388,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"435035","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Deep Wooden Chopping Board, 50cm x 35cm (ed51)","public_title":null,"options":["Default Title"],"price":4156,"weight":0,"compare_at_price":5195,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5060021830517","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/largechoppingboard_1_e3a74043-5106-4783-9c42-c915c647cf6a.jpg?v=1712783686"],"featured_image":"\/\/\/cdn\/shop\/files\/largechoppingboard_1_e3a74043-5106-4783-9c42-c915c647cf6a.jpg?v=1712783686","options":["Title"],"media":[{"alt":null,"id":46264900845913,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/files\/largechoppingboard_1_e3a74043-5106-4783-9c42-c915c647cf6a.jpg?v=1712783686"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/largechoppingboard_1_e3a74043-5106-4783-9c42-c915c647cf6a.jpg?v=1712783686","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eThis durable wooden chopping board is ideal for slicing and chopping meat and vegetables.  Complete with end finger grooves, it allows for easy handling. Handwash only. Size: 50cm x 35cm x 4cm. Made with FSC certified beechwood supplied from sustainable sources in central Europe. \u003cbr\u003e\u003c\/p\u003e"}
Deep Wooden Chopping Board, 50cm x 35cm (ed51)

Deep Wooden Chopping Board, 50cm x 35cm (ed51)


This durable wooden chopping board is ideal for slicing and chopping meat and vegetables.  Complete with end finger grooves, it allows for easy handling. Handwash only. Size: 50cm x 35cm x 4cm. Made with FSC certified beechwood supplied from sustainable sources in central Europe. 

More Info
{"id":6734134968356,"title":"Kitchencraft Wood Antipasti Tray with Metal Handles, 45cm (K59F)","handle":"kitchencraft-wood-antipasti-tray-with-metal-handles","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eCombining repurposed natural resources with brushed-effect steel, the Industrial Kitchen twin-handled serving platter is the epitome of refined elegance and rugged industrial charm. Whether it’s propped up on display on a countertop, or laden with delicious snacks and nibbles for a party, it’s sure to capture the attention of guests and visitors every time you show it off. The platter board is made from solid mango wood; which, in addition to looking truly stunning when piled high with food, is also extremely hard-wearing, so is ideal for use as a cheese board, or sharing platter where knives will be used. Uniquely beautiful and refreshingly practical to boot, the tray makes a handsome addition to any serving collection, and a fine gift for those following the modern industrial trend. Dimensions (includes handles): 45cm x 13cm x 1.9cm. Always wash wood by hand- do not soak. Comes with a 12 month guarantee\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-09-11T22:52:10+01:00","created_at":"2021-09-11T22:49:09+01:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":2150,"price_min":2150,"price_max":2150,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39578293993508,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"INDSBOARDLNG","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Kitchencraft Wood Antipasti Tray with Metal Handles, 45cm (K59F)","public_title":null,"options":["Default Title"],"price":2150,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250793959","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/woodservingplatterwithmetalhandles_1.jpg?v=1632328465"],"featured_image":"\/\/\/cdn\/shop\/products\/woodservingplatterwithmetalhandles_1.jpg?v=1632328465","options":["Title"],"media":[{"alt":null,"id":20916655063076,"position":1,"preview_image":{"aspect_ratio":1.41,"height":478,"width":674,"src":"\/\/\/cdn\/shop\/products\/woodservingplatterwithmetalhandles_1.jpg?v=1632328465"},"aspect_ratio":1.41,"height":478,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/woodservingplatterwithmetalhandles_1.jpg?v=1632328465","width":674}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eCombining repurposed natural resources with brushed-effect steel, the Industrial Kitchen twin-handled serving platter is the epitome of refined elegance and rugged industrial charm. Whether it’s propped up on display on a countertop, or laden with delicious snacks and nibbles for a party, it’s sure to capture the attention of guests and visitors every time you show it off. The platter board is made from solid mango wood; which, in addition to looking truly stunning when piled high with food, is also extremely hard-wearing, so is ideal for use as a cheese board, or sharing platter where knives will be used. Uniquely beautiful and refreshingly practical to boot, the tray makes a handsome addition to any serving collection, and a fine gift for those following the modern industrial trend. Dimensions (includes handles): 45cm x 13cm x 1.9cm. Always wash wood by hand- do not soak. Comes with a 12 month guarantee\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Kitchencraft Wood Antipasti Tray with Metal Handles, 45cm (K59F)

Kitchencraft Wood Antipasti Tray with Metal Handles, 45cm (K59F)


Combining repurposed natural resources with brushed-effect steel, the Industrial Kitchen twin-handled serving platter is the epitome of refined elegance and rugged industrial charm. Whether it’s propped up on display on a countertop, or laden with delicious snacks and nibbles for a party, it’s sure to capture the attention of guests and visito...

More Info
{"id":6617912803364,"title":"KitchenCraft Stainless Steel Stilton Spoon (K57F)","handle":"kitchencraft-stainless-steel-stilton-spoon","description":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\"\u003eTraditional shaped stainless steel spoon for removing portions of stilton without disturbing the rind. Dishwasher safe. Size: 18cm\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2021-05-17T19:32:55+01:00","created_at":"2021-05-17T19:31:55+01:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT","TABLE \u0026 BAR"],"price":395,"price_min":395,"price_max":395,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39416710299684,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCSTILTON","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"KitchenCraft Stainless Steel Stilton Spoon (K57F)","public_title":null,"options":["Default Title"],"price":395,"weight":0,"compare_at_price":null,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250122957","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/stiltonspoon.jpg?v=1712863371","\/\/\/cdn\/shop\/products\/KCSTILTON_10stiltonspoon_1.jpg?v=1712863371"],"featured_image":"\/\/\/cdn\/shop\/files\/stiltonspoon.jpg?v=1712863371","options":["Title"],"media":[{"alt":null,"id":46275141271897,"position":1,"preview_image":{"aspect_ratio":1.0,"height":567,"width":567,"src":"\/\/\/cdn\/shop\/files\/stiltonspoon.jpg?v=1712863371"},"aspect_ratio":1.0,"height":567,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/stiltonspoon.jpg?v=1712863371","width":567},{"alt":null,"id":20481612251172,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/KCSTILTON_10stiltonspoon_1.jpg?v=1712863371"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/KCSTILTON_10stiltonspoon_1.jpg?v=1712863371","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\"\u003eTraditional shaped stainless steel spoon for removing portions of stilton without disturbing the rind. Dishwasher safe. Size: 18cm\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
KitchenCraft Stainless Steel Stilton Spoon (K57F)

KitchenCraft Stainless Steel Stilton Spoon (K57F)


Traditional shaped stainless steel spoon for removing portions of stilton without disturbing the rind. Dishwasher safe. Size: 18cm

More Info
{"id":385006141476,"title":"Professional Stainless Steel Cheese Knife (k29m)","handle":"professional-stainless-steel-cheese-knife","description":"Kitchen Craft stainless steel cheese knife with a comfortable oval shaped handle and integral hanging storage loop. Dishwasher safe. Life time guarantee. Not to be sold to persons under the age of 18","published_at":"2021-05-11T20:50:45+01:00","created_at":"2017-11-22T13:47:07+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW"],"price":650,"price_min":650,"price_max":650,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4984744673316,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCPROCK","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Professional Stainless Steel Cheese Knife (k29m)","public_title":null,"options":["Default Title"],"price":650,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250117229","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/KCPROCK_20cheese_20knife.jpg?v=1712864767"],"featured_image":"\/\/\/cdn\/shop\/files\/KCPROCK_20cheese_20knife.jpg?v=1712864767","options":["Title"],"media":[{"alt":null,"id":46275390931289,"position":2,"preview_image":{"aspect_ratio":1.0,"height":491,"width":491,"src":"\/\/\/cdn\/shop\/files\/KCPROCK_20cheese_20knife.jpg?v=1712864767"},"aspect_ratio":1.0,"height":491,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/KCPROCK_20cheese_20knife.jpg?v=1712864767","width":491}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Kitchen Craft stainless steel cheese knife with a comfortable oval shaped handle and integral hanging storage loop. Dishwasher safe. Life time guarantee. Not to be sold to persons under the age of 18"}
Professional Stainless Steel Cheese Knife (k29m)

Professional Stainless Steel Cheese Knife (k29m)


Kitchen Craft stainless steel cheese knife with a comfortable oval shaped handle and integral hanging storage loop. Dishwasher safe. Life time guarantee. Not to be sold to persons under the age of 18

More Info
{"id":384837910564,"title":"Barcraft Deluxe Wine Decanting Funnel (K629)","handle":"decanting-funnel","description":"Connoisseur deluxe stylish and durable stainless steel decanting funnel, complete with an aerating nozzle, removable fine mesh filter, decanting stand, and drip tray, for effective and easy decanting time and again. Dishwasher safe. Gift boxed.","published_at":"2020-11-04T11:25:12+00:00","created_at":"2017-11-22T10:29:46+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":2295,"price_min":2295,"price_max":2295,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4983702159396,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"kcbcfunnel","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Barcraft Deluxe Wine Decanting Funnel (K629)","public_title":null,"options":["Default Title"],"price":2295,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250135629","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/products\/kitchencraftdecantingfunnel_2.jpg?v=1636465238","\/\/\/cdn\/shop\/products\/kitchencraftdecantingfunnel._1.jpg?v=1636465098","\/\/\/cdn\/shop\/products\/kitchencraftdecantingfunnel_1.jpg?v=1636465112"],"featured_image":"\/\/\/cdn\/shop\/products\/kitchencraftdecantingfunnel_2.jpg?v=1636465238","options":["Title"],"media":[{"alt":null,"id":21147092025380,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/products\/kitchencraftdecantingfunnel_2.jpg?v=1636465238"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/kitchencraftdecantingfunnel_2.jpg?v=1636465238","width":600},{"alt":null,"id":21147085701156,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/kitchencraftdecantingfunnel._1.jpg?v=1636465098"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/kitchencraftdecantingfunnel._1.jpg?v=1636465098","width":500},{"alt":null,"id":21147085733924,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/kitchencraftdecantingfunnel_1.jpg?v=1636465112"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/kitchencraftdecantingfunnel_1.jpg?v=1636465112","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Connoisseur deluxe stylish and durable stainless steel decanting funnel, complete with an aerating nozzle, removable fine mesh filter, decanting stand, and drip tray, for effective and easy decanting time and again. Dishwasher safe. Gift boxed."}
Barcraft Deluxe Wine Decanting Funnel (K629)

Barcraft Deluxe Wine Decanting Funnel (K629)


Connoisseur deluxe stylish and durable stainless steel decanting funnel, complete with an aerating nozzle, removable fine mesh filter, decanting stand, and drip tray, for effective and easy decanting time and again. Dishwasher safe. Gift boxed.

More Info
{"id":1449412624420,"title":"Bar Craft Wine Aerator (K711)","handle":"bar-craft-wine-aerator","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eGood things come to those who wait. That's especially true when it comes to letting your wine breathe. But if you didn't have to wait, you probably wouldn't. With BarCraft's Plastic Wine Aerator you can cut straight to enjoying your wine's full flavour without the wait! This clever contraption works in really simple way. Pour in your wine, straight from the bottle. The wine aerator exposes it to oxygen as it flows through - instantly bringing out a depth of flavour you'd usually have to wait hours for if you decanted it. It's ideal for serving aged reds, some whites and even vintage ports. The 16-hole design catches any cork or wine sediment, so rather than a mouthful of grit, you can savour a smooth, harmonious blend of fruity notes! 12 month guarantee. Dishwasher safe\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2020-11-28T01:28:18+00:00","created_at":"2019-07-03T23:10:01+01:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":2350,"price_min":2350,"price_max":2350,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":11647105105956,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"bcaerpl","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Bar Craft Wine Aerator (K711)","public_title":null,"options":["Default Title"],"price":2350,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250742711","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/BCAERPL_wine_aerator.jpg?v=1712954088","\/\/\/cdn\/shop\/products\/BCAERPL_wine_aerator_2.jpg?v=1712954075"],"featured_image":"\/\/\/cdn\/shop\/files\/BCAERPL_wine_aerator.jpg?v=1712954088","options":["Title"],"media":[{"alt":null,"id":46289053679961,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/\/cdn\/shop\/files\/BCAERPL_wine_aerator.jpg?v=1712954088"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/BCAERPL_wine_aerator.jpg?v=1712954088","width":600},{"alt":null,"id":2495055331364,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/\/cdn\/shop\/products\/BCAERPL_wine_aerator_2.jpg?v=1712954075"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/\/cdn\/shop\/products\/BCAERPL_wine_aerator_2.jpg?v=1712954075","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eGood things come to those who wait. That's especially true when it comes to letting your wine breathe. But if you didn't have to wait, you probably wouldn't. With BarCraft's Plastic Wine Aerator you can cut straight to enjoying your wine's full flavour without the wait! This clever contraption works in really simple way. Pour in your wine, straight from the bottle. The wine aerator exposes it to oxygen as it flows through - instantly bringing out a depth of flavour you'd usually have to wait hours for if you decanted it. It's ideal for serving aged reds, some whites and even vintage ports. The 16-hole design catches any cork or wine sediment, so rather than a mouthful of grit, you can savour a smooth, harmonious blend of fruity notes! 12 month guarantee. Dishwasher safe\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
Bar Craft Wine Aerator (K711)

Bar Craft Wine Aerator (K711)


Good things come to those who wait. That's especially true when it comes to letting your wine breathe. But if you didn't have to wait, you probably wouldn't. With BarCraft's Plastic Wine Aerator you can cut straight to enjoying your wine's full flavour without the wait! This clever contraption works in really simple way. Pour in your wine, ...

More Info
{"id":6541556547620,"title":"Reversible Cotton Bread \u0026 Napkin Basket (47R)","handle":"reversible-cotton-bread-basket","description":"\u003cp\u003eThis stylish fabric bread basket from is beautiful and practical at the same time. The unique print in a country style with a romantic look gives a cozy and lovely atmosphere to your breakfast. The daily sandwiches, baguettes or croissants become a feast with this bread basket. The bread basket is made of 100% cotton and is provided with 4 convenient ribbons to tie it together. Looks great on any occasion on the table and fits into any interior. Serve your breakfast in style!\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003e100% Cotton. Machine wash. Collapsible. Reversible. Beige Red on one side and Beige on the reverse. Lays flat for storage. Also great for napkins, silverware, etc. Size when in use:  21cm x 21cm x 7cm approx. Colour: Beige, Red.\u003c\/p\u003e","published_at":"2021-03-02T16:47:28+00:00","created_at":"2021-03-02T16:47:27+00:00","vendor":"Clayre en Eef","type":"","tags":[],"price":1250,"price_min":1250,"price_max":1250,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39255714758692,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Reversible Cotton Bread \u0026 Napkin Basket (47R)","public_title":null,"options":["Default Title"],"price":1250,"weight":0,"compare_at_price":null,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/\/cdn\/shop\/files\/reversiblecottonbreadbasket.jpg?v=1713010376"],"featured_image":"\/\/\/cdn\/shop\/files\/reversiblecottonbreadbasket.jpg?v=1713010376","options":["Title"],"media":[{"alt":null,"id":46295070212441,"position":2,"preview_image":{"aspect_ratio":1.0,"height":624,"width":624,"src":"\/\/\/cdn\/shop\/files\/reversiblecottonbreadbasket.jpg?v=1713010376"},"aspect_ratio":1.0,"height":624,"media_type":"image","src":"\/\/\/cdn\/shop\/files\/reversiblecottonbreadbasket.jpg?v=1713010376","width":624}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eThis stylish fabric bread basket from is beautiful and practical at the same time. The unique print in a country style with a romantic look gives a cozy and lovely atmosphere to your breakfast. The daily sandwiches, baguettes or croissants become a feast with this bread basket. The bread basket is made of 100% cotton and is provided with 4 convenient ribbons to tie it together. Looks great on any occasion on the table and fits into any interior. Serve your breakfast in style!\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003e100% Cotton. Machine wash. Collapsible. Reversible. Beige Red on one side and Beige on the reverse. Lays flat for storage. Also great for napkins, silverware, etc. Size when in use:  21cm x 21cm x 7cm approx. Colour: Beige, Red.\u003c\/p\u003e"}
Reversible Cotton Bread & Napkin Basket (47R)

Reversible Cotton Bread & Napkin Basket (47R)


This stylish fabric bread basket from is beautiful and practical at the same time. The unique print in a country style with a romantic look gives a cozy and lovely atmosphere to your breakfast. The daily sandwiches, baguettes or croissants become a feast with this bread basket. The bread basket is made of 100% cotton and is provided with 4 conve...

More Info