JANUARY SALE NOW ON! 20% OFF ALL PRODUCTS. USE CODE JAN22 AT CHECKOUT.

TABLE & BAR

Sort by:
{"id":4794136297508,"title":"4 Tier Fold Up Card Cupcake Stand (K853)","handle":"4-tier-fold-up-card-cake-stand","description":"Perfect for weddings and other celebrations, this four tier card cake stand holds and presents cupcakes and a variety of other delicious and tasty treats! Easy to assemble, this stand holds up to 36 cupcakes. Disposable items. Size: 48.5cm x 42cm. Holds up to 36 cupcakes","published_at":"2020-11-28T01:39:40+00:00","created_at":"2020-07-27T14:08:31+01:00","vendor":"Kitchencraft","type":"","tags":["BAKEWARE \u0026 SUGARCRAFT","KITCHENCRAFT","TABLE \u0026 BAR"],"price":495,"price_min":495,"price_max":495,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32243236962340,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"SDI4TCSTAND","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"4 Tier Fold Up Card Cupcake Stand (K853)","public_title":null,"options":["Default Title"],"price":495,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250495853","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/SDI4TCSTANDFOLDUPCAKESTAND.jpg?v=1595855527"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/SDI4TCSTANDFOLDUPCAKESTAND.jpg?v=1595855527","options":["Title"],"media":[{"alt":null,"id":7169977188388,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/SDI4TCSTANDFOLDUPCAKESTAND.jpg?v=1595855527"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/SDI4TCSTANDFOLDUPCAKESTAND.jpg?v=1595855527","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Perfect for weddings and other celebrations, this four tier card cake stand holds and presents cupcakes and a variety of other delicious and tasty treats! Easy to assemble, this stand holds up to 36 cupcakes. Disposable items. Size: 48.5cm x 42cm. Holds up to 36 cupcakes"}
4 Tier Fold Up Card Cupcake Stand (K853)

4 Tier Fold Up Card Cupcake Stand (K853)

€4.95

Perfect for weddings and other celebrations, this four tier card cake stand holds and presents cupcakes and a variety of other delicious and tasty treats! Easy to assemble, this stand holds up to 36 cupcakes. Disposable items. Size: 48.5cm x 42cm. Holds up to 36 cupcakes


More Info
{"id":6835543539748,"title":"ACRYLIC CHAMPAGNE BUCKET \u0026 WINE COOLER (ed02)","handle":"acrylic-champagne-bucket-wine-cooler","description":"\u003cp\u003eA useful acrylic drinks pail to chill wine, water and champagne bottles. With a stylish angled shape with integrated handles, the pail is ideal for dinner parties and small get togethers. Size:  23 x 23 x 18cm\u003c\/p\u003e","published_at":"2021-11-26T23:14:14+00:00","created_at":"2021-11-26T22:51:06+00:00","vendor":"Eddingtons","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":1695,"price_min":1695,"price_max":1695,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39755237687332,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"39F1257","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"ACRYLIC CHAMPAGNE BUCKET \u0026 WINE COOLER (ed02)","public_title":null,"options":["Default Title"],"price":1695,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"4710900632602","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/acrylicchampagneandwinedrinkspail_1.jpg?v=1638283851"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/acrylicchampagneandwinedrinkspail_1.jpg?v=1638283851","options":["Title"],"media":[{"alt":null,"id":21287626211364,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/acrylicchampagneandwinedrinkspail_1.jpg?v=1638283851"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/acrylicchampagneandwinedrinkspail_1.jpg?v=1638283851","width":700}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eA useful acrylic drinks pail to chill wine, water and champagne bottles. With a stylish angled shape with integrated handles, the pail is ideal for dinner parties and small get togethers. Size:  23 x 23 x 18cm\u003c\/p\u003e"}
ACRYLIC CHAMPAGNE BUCKET & WINE COOLER (ed02)

ACRYLIC CHAMPAGNE BUCKET & WINE COOLER (ed02)

€16.95

A useful acrylic drinks pail to chill wine, water and champagne bottles. With a stylish angled shape with integrated handles, the pail is ideal for dinner parties and small get togethers. Size:  23 x 23 x 18cm


More Info
{"id":383775178788,"title":"Acrylic Double Walled Wine Cooler (k309)","handle":"acrylic-double-walled-wine-cooler","description":"Bar Craft clear acrylic wine cooler with a contrasting polished silver rim and base. Stylish for use directly at the table to keep chilled wine cooler for longer. Handwash only. Display boxed.","published_at":"2020-11-28T12:09:49+00:00","created_at":"2017-11-21T17:04:50+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":1595,"price_min":1595,"price_max":1595,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4975460810788,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCWCOOL","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Acrylic Double Walled Wine Cooler (k309)","public_title":null,"options":["Default Title"],"price":1595,"weight":0,"compare_at_price":null,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250125309","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/doublewalledwinecooler.jpg?v=1636750983","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/doublewalledwinecooler..jpg?v=1636750996"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/doublewalledwinecooler.jpg?v=1636750983","options":["Title"],"media":[{"alt":null,"id":21173333131300,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/doublewalledwinecooler.jpg?v=1636750983"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/doublewalledwinecooler.jpg?v=1636750983","width":600},{"alt":null,"id":21173333098532,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/doublewalledwinecooler..jpg?v=1636750996"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/doublewalledwinecooler..jpg?v=1636750996","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Bar Craft clear acrylic wine cooler with a contrasting polished silver rim and base. Stylish for use directly at the table to keep chilled wine cooler for longer. Handwash only. Display boxed."}
Acrylic Double Walled Wine Cooler (k309)

Acrylic Double Walled Wine Cooler (k309)

€15.95

Bar Craft clear acrylic wine cooler with a contrasting polished silver rim and base. Stylish for use directly at the table to keep chilled wine cooler for longer. Handwash only. Display boxed.


More Info
{"id":6845372563492,"title":"Artesà Appetiser Acacia Wood Serving \u0026 Baguette Board, 48cm","handle":"artesa-appetiser-acacia-wood-serving-baguette-board","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eIncreasingly the way to serve cold meats, pickles, antipasti and of course a selection of bread, this natural acacia wood board features heavy grain and a decorative motif for added style. We recommend hand washing. Size: 48cm x 13cm (19\" x 5\")\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-12-13T21:42:55+00:00","created_at":"2021-12-01T21:27:45+00:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":1795,"price_min":1795,"price_max":1795,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39773818454052,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTBBOARD","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Appetiser Acacia Wood Serving \u0026 Baguette Board, 48cm","public_title":null,"options":["Default Title"],"price":1795,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250472564","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodenservingplankboard.jpg?v=1638394340","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodenservingplankboard_069e627e-ba81-4d35-9bd7-19de09be52f6.jpg?v=1638394340"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodenservingplankboard.jpg?v=1638394340","options":["Title"],"media":[{"alt":null,"id":21295259156516,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodenservingplankboard.jpg?v=1638394340"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodenservingplankboard.jpg?v=1638394340","width":700},{"alt":null,"id":21295255715876,"position":2,"preview_image":{"aspect_ratio":1.0,"height":690,"width":690,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodenservingplankboard_069e627e-ba81-4d35-9bd7-19de09be52f6.jpg?v=1638394340"},"aspect_ratio":1.0,"height":690,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodenservingplankboard_069e627e-ba81-4d35-9bd7-19de09be52f6.jpg?v=1638394340","width":690}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eIncreasingly the way to serve cold meats, pickles, antipasti and of course a selection of bread, this natural acacia wood board features heavy grain and a decorative motif for added style. We recommend hand washing. Size: 48cm x 13cm (19\" x 5\")\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Appetiser Acacia Wood Serving & Baguette Board, 48cm

Artesà Appetiser Acacia Wood Serving & Baguette Board, 48cm

€17.95

Increasingly the way to serve cold meats, pickles, antipasti and of course a selection of bread, this natural acacia wood board features heavy grain and a decorative motif for added style. We recommend hand washing. Size: 48cm x 13cm (19" x 5")


More Info
{"id":6602013343780,"title":"Artesà Appetiser Slate Serving Platter, 60cm (K859)","handle":"artesa-appetiser-slate-serving-platter","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eShowcase a smorgasbord of antipasti, desserts or entrees with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal handles also make it easy to carry around to guests and also to use as a tray for serving individual dessert or dipping pots. Make a statement. Part of the Artesà range of hand finished dining and serving items. Wipe clean only. 5 year guarantee. Size: 60cm x 15cm. Includes: 1 x slate serving platter and 2 x metal handles. Gift boxed\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-05-02T12:38:33+01:00","created_at":"2021-05-02T12:33:18+01:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":2295,"price_min":2295,"price_max":2295,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39395178151972,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTPLATTER","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Appetiser Slate Serving Platter, 60cm (K859)","public_title":null,"options":["Default Title"],"price":2295,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250480859","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTER_20servingplattergrazingplatter_37a4fa42-c906-431b-8492-04b2e723c41a.jpg?v=1619955627","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTERservingplattergrazingplatter.jpg?v=1619955383","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTER_10servingplattergrazingplatter.jpg?v=1619955395"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTER_20servingplattergrazingplatter_37a4fa42-c906-431b-8492-04b2e723c41a.jpg?v=1619955627","options":["Title"],"media":[{"alt":null,"id":20423767687204,"position":1,"preview_image":{"aspect_ratio":2.959,"height":169,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTER_20servingplattergrazingplatter_37a4fa42-c906-431b-8492-04b2e723c41a.jpg?v=1619955627"},"aspect_ratio":2.959,"height":169,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTER_20servingplattergrazingplatter_37a4fa42-c906-431b-8492-04b2e723c41a.jpg?v=1619955627","width":500},{"alt":null,"id":20423758676004,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTERservingplattergrazingplatter.jpg?v=1619955383"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTERservingplattergrazingplatter.jpg?v=1619955383","width":500},{"alt":null,"id":20423758708772,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTER_10servingplattergrazingplatter.jpg?v=1619955395"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTER_10servingplattergrazingplatter.jpg?v=1619955395","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eShowcase a smorgasbord of antipasti, desserts or entrees with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal handles also make it easy to carry around to guests and also to use as a tray for serving individual dessert or dipping pots. Make a statement. Part of the Artesà range of hand finished dining and serving items. Wipe clean only. 5 year guarantee. Size: 60cm x 15cm. Includes: 1 x slate serving platter and 2 x metal handles. Gift boxed\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Appetiser Slate Serving Platter, 60cm (K859)

Artesà Appetiser Slate Serving Platter, 60cm (K859)

€22.95

Showcase a smorgasbord of antipasti, desserts or entrees with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal handles also make it easy to carry around to guests and also to use as a tra...


More Info
Sale
Artesà Copper Mini Serving Pot With Handles, 12cm (k952)
{"id":4990478975012,"title":"Artesà Copper Mini Serving Pot With Handles, 12cm (k952)","handle":"artesa-hammered-copper-mini-saucepan-serving-pot-12cm","description":"\u003cp\u003eCreate an instant, quirky gastro pub feel at your next dinner party, by serving up delicious dishes using this hammered copper serving pot. Copper has a warm, vibrant glow that’s sure to light up the room whenever this dish is around It’s reflective, hammered finish lends an quirky, industrial feel and restaurant would envy, complete with contrasting gold coloured handles bolted on to the sides. Practical too, the handles make it easy to move the pan around, so your guests can pass the dish along the table with ease. At 12 cm (4½\") in diameter, this serving dish is the ideal size for individual portions or for sharing rice, vegetables or curries. Give each diner their own hammered copper dish when you’re serving starters or use it to present sides or tapas selections that everyone can share. Copper finish. Food safe. Handwash only. Please note: this saucepan is for serving only and not suitable for stovetop use\u003cbr\u003e\u003c\/p\u003e","published_at":"2020-11-22T21:47:15+00:00","created_at":"2020-11-22T21:40:35+00:00","vendor":"EA Symmons","type":"","tags":["COOKWARE","KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","SAUCEPAN","STOCK POT","STOCKPOT","TABLE \u0026 BAR"],"price":1495,"price_min":1495,"price_max":1495,"available":true,"price_varies":false,"compare_at_price":1995,"compare_at_price_min":1995,"compare_at_price_max":1995,"compare_at_price_varies":false,"variants":[{"id":32482344927268,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"artminipot12","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Copper Mini Serving Pot With Handles, 12cm (k952)","public_title":null,"options":["Default Title"],"price":1495,"weight":0,"compare_at_price":1995,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250776952","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/artminipot8minicoppersaucepan_1.jpg?v=1636842356"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/artminipot8minicoppersaucepan_1.jpg?v=1636842356","options":["Title"],"media":[{"alt":null,"id":21184630751268,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/artminipot8minicoppersaucepan_1.jpg?v=1636842356"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/artminipot8minicoppersaucepan_1.jpg?v=1636842356","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eCreate an instant, quirky gastro pub feel at your next dinner party, by serving up delicious dishes using this hammered copper serving pot. Copper has a warm, vibrant glow that’s sure to light up the room whenever this dish is around It’s reflective, hammered finish lends an quirky, industrial feel and restaurant would envy, complete with contrasting gold coloured handles bolted on to the sides. Practical too, the handles make it easy to move the pan around, so your guests can pass the dish along the table with ease. At 12 cm (4½\") in diameter, this serving dish is the ideal size for individual portions or for sharing rice, vegetables or curries. Give each diner their own hammered copper dish when you’re serving starters or use it to present sides or tapas selections that everyone can share. Copper finish. Food safe. Handwash only. Please note: this saucepan is for serving only and not suitable for stovetop use\u003cbr\u003e\u003c\/p\u003e"}
Artesà Copper Mini Serving Pot With Handles, 12cm (k952)

Artesà Copper Mini Serving Pot With Handles, 12cm (k952)

€14.95

Create an instant, quirky gastro pub feel at your next dinner party, by serving up delicious dishes using this hammered copper serving pot. Copper has a warm, vibrant glow that’s sure to light up the room whenever this dish is around It’s reflective, hammered finish lends an quirky, industrial feel and restaurant would envy, complete with contra...


More Info
Sale
Artesà Copper Mini Serving Pot With Handles, 8cm (k869)
{"id":4990486675492,"title":"Artesà Copper Mini Serving Pot With Handles, 8cm (k869)","handle":"artesa-copper-mini-serving-pot-with-handles-i8cm","description":"\u003cp\u003eCreate an instant, quirky gastro pub feel at your next dinner party, by serving up delicious dishes using this hammered copper serving pot. Copper has a warm, vibrant glow that’s sure to light up the room whenever this dish is around It’s reflective, hammered finish lends an quirky, industrial feel and restaurant would envy, complete with contrasting gold coloured handles bolted on to the sides. Practical too, the handles make it easy to move the pan around, so your guests can pass the dish along the table with ease. This 8 cm (3 inch) round dish has high sides, so you can use it to serve up all manner of different nibbles and sides, from nuts and rice, to chips and dips. Give each diner their own hammered copper dish when you’re serving starters or use it to present sides or tapas selections that everyone can share. Copper finish. Food safe. Handwash only. Please note: this saucepan is for serving only and not suitable for stovetop use\u003cbr\u003e\u003c\/p\u003e","published_at":"2020-11-22T21:56:55+00:00","created_at":"2020-11-22T21:55:04+00:00","vendor":"EA Symmons","type":"","tags":["COOKWARE","KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","SAUCEPAN","STOCK POT","STOCKPOT","TABLE \u0026 BAR"],"price":895,"price_min":895,"price_max":895,"available":true,"price_varies":false,"compare_at_price":1495,"compare_at_price_min":1495,"compare_at_price_max":1495,"compare_at_price_varies":false,"variants":[{"id":32482351480868,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTMINIPOT8","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Copper Mini Serving Pot With Handles, 8cm (k869)","public_title":null,"options":["Default Title"],"price":895,"weight":0,"compare_at_price":1495,"inventory_quantity":6,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250760869","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTMINIPOT8_01copperminiservingpot_1.jpg?v=1636842418"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTMINIPOT8_01copperminiservingpot_1.jpg?v=1636842418","options":["Title"],"media":[{"alt":null,"id":21184636780580,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTMINIPOT8_01copperminiservingpot_1.jpg?v=1636842418"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTMINIPOT8_01copperminiservingpot_1.jpg?v=1636842418","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eCreate an instant, quirky gastro pub feel at your next dinner party, by serving up delicious dishes using this hammered copper serving pot. Copper has a warm, vibrant glow that’s sure to light up the room whenever this dish is around It’s reflective, hammered finish lends an quirky, industrial feel and restaurant would envy, complete with contrasting gold coloured handles bolted on to the sides. Practical too, the handles make it easy to move the pan around, so your guests can pass the dish along the table with ease. This 8 cm (3 inch) round dish has high sides, so you can use it to serve up all manner of different nibbles and sides, from nuts and rice, to chips and dips. Give each diner their own hammered copper dish when you’re serving starters or use it to present sides or tapas selections that everyone can share. Copper finish. Food safe. Handwash only. Please note: this saucepan is for serving only and not suitable for stovetop use\u003cbr\u003e\u003c\/p\u003e"}
Artesà Copper Mini Serving Pot With Handles, 8cm (k869)

Artesà Copper Mini Serving Pot With Handles, 8cm (k869)

€8.95

Create an instant, quirky gastro pub feel at your next dinner party, by serving up delicious dishes using this hammered copper serving pot. Copper has a warm, vibrant glow that’s sure to light up the room whenever this dish is around It’s reflective, hammered finish lends an quirky, industrial feel and restaurant would envy, complete with contra...


More Info
Sale
Artesà Copper Tri-ply Mini Saucepan, 8.5.cm (k222)
{"id":4990306058276,"title":"Artesà Copper Tri-ply Mini Saucepan, 8.5.cm (k222)","handle":"artesa-copper-tri-ply-mini-saucepan-8-5-cm","description":"\u003cp\u003eBeautifully quaint, effortlessly elegant. This stainless steel and copper tri-ply mini saucepan is ideal for cooking sauces and serving starters, appetisers and accompaniments. With a triply base for durability and even heat distribution, this mini saucepan is perfect for enjoying fine dining in true artisan style with friends and family. Handwash only. 5 year guarantee. Size: 8.5cm\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/p\u003e","published_at":"2020-11-22T21:33:42+00:00","created_at":"2020-11-22T18:46:45+00:00","vendor":"EA Symmons","type":"","tags":["COOKWARE","KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","SAUCEPAN","STOCK POT","STOCKPOT","TABLE \u0026 BAR"],"price":1695,"price_min":1695,"price_max":1695,"available":true,"price_varies":false,"compare_at_price":2695,"compare_at_price_min":2695,"compare_at_price_max":2695,"compare_at_price_varies":false,"variants":[{"id":32482211233828,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTMSAUC8","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Copper Tri-ply Mini Saucepan, 8.5.cm (k222)","public_title":null,"options":["Default Title"],"price":1695,"weight":0,"compare_at_price":2695,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250666222","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTMSAUC8minicoppersaucepan_1.jpg?v=1636842541","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTMSAUC8minicoppersaucepan2.jpg?v=1606080264"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTMSAUC8minicoppersaucepan_1.jpg?v=1636842541","options":["Title"],"media":[{"alt":null,"id":21184642482212,"position":1,"preview_image":{"aspect_ratio":1.0,"height":423,"width":423,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTMSAUC8minicoppersaucepan_1.jpg?v=1636842541"},"aspect_ratio":1.0,"height":423,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTMSAUC8minicoppersaucepan_1.jpg?v=1636842541","width":423},{"alt":null,"id":7676026847268,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTMSAUC8minicoppersaucepan2.jpg?v=1606080264"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTMSAUC8minicoppersaucepan2.jpg?v=1606080264","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eBeautifully quaint, effortlessly elegant. This stainless steel and copper tri-ply mini saucepan is ideal for cooking sauces and serving starters, appetisers and accompaniments. With a triply base for durability and even heat distribution, this mini saucepan is perfect for enjoying fine dining in true artisan style with friends and family. Handwash only. 5 year guarantee. Size: 8.5cm\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/p\u003e"}
Artesà Copper Tri-ply Mini Saucepan, 8.5.cm (k222)

Artesà Copper Tri-ply Mini Saucepan, 8.5.cm (k222)

€16.95

Beautifully quaint, effortlessly elegant. This stainless steel and copper tri-ply mini saucepan is ideal for cooking sauces and serving starters, appetisers and accompaniments. With a triply base for durability and even heat distribution, this mini saucepan is perfect for enjoying fine dining in true artisan style with friends and family. Handwa...


More Info
{"id":6617178996772,"title":"Artesà Gourmet Cheese Brie Baker (k277)","handle":"artesa-gourmet-cheese-brie-baker","description":"Cheese and wine has never been more popular and this cheese baker is ideal for adding a touch of luxury to serving. Perfect for indulging in a deliciously melted cheese starter or adding a warm twist to traditional cheese boards, this cheese baker is suitable for baking in the oven and also a sophisticated way to serve Camembert at the dining table. This ceramic baking dish is a beautiful quality piece for entertaining at home with a vintage red cheese label design. Dimensions: 4.75 x 2\/120mm (diameter) x 55mm.","published_at":"2021-05-16T20:43:21+01:00","created_at":"2021-05-16T20:42:29+01:00","vendor":"Kitchencraft","type":"","tags":["COOKWARE","KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","TABLE \u0026 BAR","The Hostess"],"price":2195,"price_min":2195,"price_max":2195,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39415724245028,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"5122277","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Gourmet Cheese Brie Baker (k277)","public_title":null,"options":["Default Title"],"price":2195,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5050993157156","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5122277_20briebaker.jpg?v=1632328971","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5122277briebaker_1.jpg?v=1632328846"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5122277_20briebaker.jpg?v=1632328971","options":["Title"],"media":[{"alt":null,"id":20477807689764,"position":1,"preview_image":{"aspect_ratio":1.257,"height":389,"width":489,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5122277_20briebaker.jpg?v=1632328971"},"aspect_ratio":1.257,"height":389,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5122277_20briebaker.jpg?v=1632328971","width":489},{"alt":null,"id":20916666826788,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5122277briebaker_1.jpg?v=1632328846"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5122277briebaker_1.jpg?v=1632328846","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Cheese and wine has never been more popular and this cheese baker is ideal for adding a touch of luxury to serving. Perfect for indulging in a deliciously melted cheese starter or adding a warm twist to traditional cheese boards, this cheese baker is suitable for baking in the oven and also a sophisticated way to serve Camembert at the dining table. This ceramic baking dish is a beautiful quality piece for entertaining at home with a vintage red cheese label design. Dimensions: 4.75 x 2\/120mm (diameter) x 55mm."}
Artesà Gourmet Cheese Brie Baker (k277)

Artesà Gourmet Cheese Brie Baker (k277)

€21.95

Cheese and wine has never been more popular and this cheese baker is ideal for adding a touch of luxury to serving. Perfect for indulging in a deliciously melted cheese starter or adding a warm twist to traditional cheese boards, this cheese baker is suitable for baking in the oven and also a sophisticated way to serve Camembert at the dining ta...


More Info
{"id":4793551290404,"title":"Artesa Hand Finished Copper Effect Fondue Set (k965)","handle":"artesa-hand-finished-copper-effect-fondue-set","description":"Put the finishing touches to your evening of elegance with a gorgeous copper finish fondue set, complete with six forks so friends, family and guests can all enjoy! Ideal for a cheese, meat or chocolate fondue (although we would definitely not recommend mixing all 3 at the same time), this set looks gorgeous on a dining table, sitting beautifully in both classic and contemporary styled homes. Fondue pot is handwash only. Wipe clean only the stand and burner once cool. Set includes: 1 x stainless steel copper finish fondue pot, 1 x metal rack, 6 x forks, 1 x burner \u0026amp; 1 x diffuser. Gift boxed. \u003cmeta charset=\"utf-8\"\u003e\u003cem data-mce-fragment=\"1\"\u003e\u003cstrong data-mce-fragment=\"1\"\u003eDON'T FORGET TO PICK UP THE FONDUE GEL FUEL, PACK OF 3 (D540) AVAILABLE ON OUR WEBSITE.\u003c\/strong\u003e\u003c\/em\u003e\u003cbr\u003e","published_at":"2021-05-10T21:14:18+01:00","created_at":"2020-07-27T09:37:58+01:00","vendor":"Kitchencraft","type":"","tags":["COOKWARE","KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","TABLE \u0026 BAR"],"price":7795,"price_min":7795,"price_max":7795,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32242689802276,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTFONCOP","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesa Hand Finished Copper Effect Fondue Set (k965)","public_title":null,"options":["Default Title"],"price":7795,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250589965","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTFONCOPfonduesetcopper.jpg?v=1595839119","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTFONCOPfonduesetcopper2.jpg?v=1595839119"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTFONCOPfonduesetcopper.jpg?v=1595839119","options":["Title"],"media":[{"alt":null,"id":7168641040420,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTFONCOPfonduesetcopper.jpg?v=1595839119"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTFONCOPfonduesetcopper.jpg?v=1595839119","width":500},{"alt":null,"id":7168641007652,"position":2,"preview_image":{"aspect_ratio":1.0,"height":482,"width":482,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTFONCOPfonduesetcopper2.jpg?v=1595839119"},"aspect_ratio":1.0,"height":482,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTFONCOPfonduesetcopper2.jpg?v=1595839119","width":482}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Put the finishing touches to your evening of elegance with a gorgeous copper finish fondue set, complete with six forks so friends, family and guests can all enjoy! Ideal for a cheese, meat or chocolate fondue (although we would definitely not recommend mixing all 3 at the same time), this set looks gorgeous on a dining table, sitting beautifully in both classic and contemporary styled homes. Fondue pot is handwash only. Wipe clean only the stand and burner once cool. Set includes: 1 x stainless steel copper finish fondue pot, 1 x metal rack, 6 x forks, 1 x burner \u0026amp; 1 x diffuser. Gift boxed. \u003cmeta charset=\"utf-8\"\u003e\u003cem data-mce-fragment=\"1\"\u003e\u003cstrong data-mce-fragment=\"1\"\u003eDON'T FORGET TO PICK UP THE FONDUE GEL FUEL, PACK OF 3 (D540) AVAILABLE ON OUR WEBSITE.\u003c\/strong\u003e\u003c\/em\u003e\u003cbr\u003e"}
Artesa Hand Finished Copper Effect Fondue Set (k965)

Artesa Hand Finished Copper Effect Fondue Set (k965)

€77.95

Put the finishing touches to your evening of elegance with a gorgeous copper finish fondue set, complete with six forks so friends, family and guests can all enjoy! Ideal for a cheese, meat or chocolate fondue (although we would definitely not recommend mixing all 3 at the same time), this set looks gorgeous on a dining table, sitting beautifull...


More Info
{"id":6799040806948,"title":"Artesà Hand Finished Serving Platter with Copper Handles, 60cm (ke01)","handle":"artesa-hand-finished-serving-platter-with-copper-handles","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eShowcase a smorgasbord of antipasti, desserts or entrées with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal copper coloured handles also make it easy to carry around to guests and also to use as a tray for serving individual dessert or dipping pots. Wipe clean only. Set includes: 1 x slate serving platter. 2 x copper handles. Size: 60cm x 15cm x 3.5cm. Gift boxed.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-11-01T22:41:03+00:00","created_at":"2021-11-01T22:34:39+00:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":2295,"price_min":2295,"price_max":2295,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39677677961252,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTPLATTERCOP","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Hand Finished Serving Platter with Copper Handles, 60cm (ke01)","public_title":null,"options":["Default Title"],"price":2295,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250687401","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTERCOP_21slateservingplatter_1.jpg?v=1635806510","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTERCOPslateservingplatter.jpg?v=1635806324","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTERCOP_10slateservingplatter.jpg?v=1635806357"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTERCOP_21slateservingplatter_1.jpg?v=1635806510","options":["Title"],"media":[{"alt":null,"id":21106468225060,"position":1,"preview_image":{"aspect_ratio":1.408,"height":426,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTERCOP_21slateservingplatter_1.jpg?v=1635806510"},"aspect_ratio":1.408,"height":426,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTERCOP_21slateservingplatter_1.jpg?v=1635806510","width":600},{"alt":null,"id":21106460393508,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTERCOPslateservingplatter.jpg?v=1635806324"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTERCOPslateservingplatter.jpg?v=1635806324","width":600},{"alt":null,"id":21106462556196,"position":3,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTERCOP_10slateservingplatter.jpg?v=1635806357"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTPLATTERCOP_10slateservingplatter.jpg?v=1635806357","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eShowcase a smorgasbord of antipasti, desserts or entrées with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal copper coloured handles also make it easy to carry around to guests and also to use as a tray for serving individual dessert or dipping pots. Wipe clean only. Set includes: 1 x slate serving platter. 2 x copper handles. Size: 60cm x 15cm x 3.5cm. Gift boxed.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Hand Finished Serving Platter with Copper Handles, 60cm (ke01)

Artesà Hand Finished Serving Platter with Copper Handles, 60cm (ke01)

€22.95

Showcase a smorgasbord of antipasti, desserts or entrées with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal copper coloured handles also make it easy to carry around to guests and also...


More Info
{"id":6734127824932,"title":"Artesà Rectangular Cheese \u0026 Wine Pairing Slate Platter, 30cm (K406)","handle":"artesa-rectangular-slate-cheese-wine-pairing-platter","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eServe up some style at dinner parties and family feasts with this elegant slate cheese and wine pairing serving board. Make a stylish and informative statement when you’re next hosting a dinner party for friends and family with this elegant slate cheese pairing serving board from the Artesà range. The cheese board is beautifully illustrated with cheese and wine pairings. Measures 30 x 40 cm. Made from natural slate material. Wipe clean only. \u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-09-11T22:46:40+01:00","created_at":"2021-09-11T22:36:46+01:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":1295,"price_min":1295,"price_max":1295,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39578290880548,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTCHSPAIRING","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Rectangular Cheese \u0026 Wine Pairing Slate Platter, 30cm (K406)","public_title":null,"options":["Default Title"],"price":1295,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250794406","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cheeseandwineslateboard_1.jpg?v=1632328585","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cheeseandwineslateboard..jpg?v=1631396763"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cheeseandwineslateboard_1.jpg?v=1632328585","options":["Title"],"media":[{"alt":null,"id":20916658110500,"position":1,"preview_image":{"aspect_ratio":1.256,"height":507,"width":637,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cheeseandwineslateboard_1.jpg?v=1632328585"},"aspect_ratio":1.256,"height":507,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cheeseandwineslateboard_1.jpg?v=1632328585","width":637},{"alt":null,"id":20875880726564,"position":2,"preview_image":{"aspect_ratio":1.408,"height":426,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cheeseandwineslateboard..jpg?v=1631396763"},"aspect_ratio":1.408,"height":426,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cheeseandwineslateboard..jpg?v=1631396763","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eServe up some style at dinner parties and family feasts with this elegant slate cheese and wine pairing serving board. Make a stylish and informative statement when you’re next hosting a dinner party for friends and family with this elegant slate cheese pairing serving board from the Artesà range. The cheese board is beautifully illustrated with cheese and wine pairings. Measures 30 x 40 cm. Made from natural slate material. Wipe clean only. \u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Rectangular Cheese & Wine Pairing Slate Platter, 30cm (K406)

Artesà Rectangular Cheese & Wine Pairing Slate Platter, 30cm (K406)

€12.95

Serve up some style at dinner parties and family feasts with this elegant slate cheese and wine pairing serving board. Make a stylish and informative statement when you’re next hosting a dinner party for friends and family with this elegant slate cheese pairing serving board from the Artesà range. The cheese board is beautifully illustrated wi...


More Info
{"id":6845328883748,"title":"Artesà Stainless Steel Butter Knife, Rose Gold","handle":"artesa-stainless-steel-butter-knife-set","description":"Make a statement at the dinner table with these stylish, mirror polished butter knivfe. The perfect accompaniment to any side plate. An easy addition to the table top, it features etched detailing, sure to provoke admiring comments and appreciative glances. The stainless steel butter blade is a naturally cool material allowing you spread evenly across bread, toast and croissants. The warm rose gold handle sits in a harmonious fashion against the minimal steel. This beautiful butter knivfe sits apart from existing cutlery, adding a unique sophisticated twist to your serveware collection. Whether it's a dinner party or a celebration breakfast, it adds the perfect touch to your everyday and special occasion dining. \u003cspan data-mce-fragment=\"1\"\u003eSize: 12cm\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e","published_at":"2021-12-13T22:07:22+00:00","created_at":"2021-12-01T19:45:38+00:00","vendor":"Kitchencraft","type":"","tags":["TABLE \u0026 BAR"],"price":295,"price_min":295,"price_max":295,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39773684662308,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTBUTKNPK4","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Stainless Steel Butter Knife, Rose Gold","public_title":null,"options":["Default Title"],"price":295,"weight":0,"compare_at_price":null,"inventory_quantity":8,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250714190","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/butterknife.jpg?v=1638388128"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/butterknife.jpg?v=1638388128","options":["Title"],"media":[{"alt":null,"id":21294822817828,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/butterknife.jpg?v=1638388128"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/butterknife.jpg?v=1638388128","width":700}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Make a statement at the dinner table with these stylish, mirror polished butter knivfe. The perfect accompaniment to any side plate. An easy addition to the table top, it features etched detailing, sure to provoke admiring comments and appreciative glances. The stainless steel butter blade is a naturally cool material allowing you spread evenly across bread, toast and croissants. The warm rose gold handle sits in a harmonious fashion against the minimal steel. This beautiful butter knivfe sits apart from existing cutlery, adding a unique sophisticated twist to your serveware collection. Whether it's a dinner party or a celebration breakfast, it adds the perfect touch to your everyday and special occasion dining. \u003cspan data-mce-fragment=\"1\"\u003eSize: 12cm\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e"}
Artesà Stainless Steel Butter Knife, Rose Gold

Artesà Stainless Steel Butter Knife, Rose Gold

€2.95

Make a statement at the dinner table with these stylish, mirror polished butter knivfe. The perfect accompaniment to any side plate. An easy addition to the table top, it features etched detailing, sure to provoke admiring comments and appreciative glances. The stainless steel butter blade is a naturally cool material allowing you spread evenly ...


More Info
{"id":6845353656356,"title":"Artesà Wood \u0026 Removable Slate Serving Board, 38cm","handle":"artesa-detachable-acacia-wood-slate-serving-board","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eYou can't make a bigger style statement, than with this sophisticated acacia wood and slate serving board from the Artesà range at KitchenCraft. The serving board is perfect for presenting and serving cheese, antipasti as well as desserts. The slate platter is removable, which makes it ideal for using at dinner parties and gatherings with friends and family. The serving board is charming, unique, impressive and nostalgic all at once - a great way to make guests feel special at a dinner party. Measures 38 x 16 cm (15 x 6 inches). Wipe clean only. Made from natural acacia wood. Slate platter. Comes with a 5 year guarantee\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-12-13T21:57:29+00:00","created_at":"2021-12-01T20:34:59+00:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":2195,"price_min":2195,"price_max":2195,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39773765664804,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTSERVLEATH","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Wood \u0026 Removable Slate Serving Board, 38cm","public_title":null,"options":["Default Title"],"price":2195,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250794376","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodandslateservingplatter.jpg?v=1638391229","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodandslateservingplatter_554d8022-ef3a-4e9b-bcdb-ff24d9c20ec0.jpg?v=1638391246","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodandslateservingplatter_9d65dc3c-f96d-4e93-90cf-8dc73bb97dd9.jpg?v=1638391271"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodandslateservingplatter.jpg?v=1638391229","options":["Title"],"media":[{"alt":null,"id":21295039545380,"position":1,"preview_image":{"aspect_ratio":1.257,"height":557,"width":700,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodandslateservingplatter.jpg?v=1638391229"},"aspect_ratio":1.257,"height":557,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodandslateservingplatter.jpg?v=1638391229","width":700},{"alt":null,"id":21295039512612,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodandslateservingplatter_554d8022-ef3a-4e9b-bcdb-ff24d9c20ec0.jpg?v=1638391246"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodandslateservingplatter_554d8022-ef3a-4e9b-bcdb-ff24d9c20ec0.jpg?v=1638391246","width":600},{"alt":null,"id":21295039578148,"position":3,"preview_image":{"aspect_ratio":1.257,"height":557,"width":700,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodandslateservingplatter_9d65dc3c-f96d-4e93-90cf-8dc73bb97dd9.jpg?v=1638391271"},"aspect_ratio":1.257,"height":557,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/woodandslateservingplatter_9d65dc3c-f96d-4e93-90cf-8dc73bb97dd9.jpg?v=1638391271","width":700}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eYou can't make a bigger style statement, than with this sophisticated acacia wood and slate serving board from the Artesà range at KitchenCraft. The serving board is perfect for presenting and serving cheese, antipasti as well as desserts. The slate platter is removable, which makes it ideal for using at dinner parties and gatherings with friends and family. The serving board is charming, unique, impressive and nostalgic all at once - a great way to make guests feel special at a dinner party. Measures 38 x 16 cm (15 x 6 inches). Wipe clean only. Made from natural acacia wood. Slate platter. Comes with a 5 year guarantee\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Wood & Removable Slate Serving Board, 38cm

Artesà Wood & Removable Slate Serving Board, 38cm

€21.95

You can't make a bigger style statement, than with this sophisticated acacia wood and slate serving board from the Artesà range at KitchenCraft. The serving board is perfect for presenting and serving cheese, antipasti as well as desserts. The slate platter is removable, which makes it ideal for using at dinner parties and gatherings with frie...


More Info
{"id":386567634980,"title":"ArtesàNatural Marble Hot Stone Grill (k808)","handle":"artesa-natural-marble-hot-stone-grill","description":"This hot stone grill allows two or more diners to enjoy the sizzling sensation of cooking on the rock! Big enough for a selection of cuts, whether that's all meat for a posh mixed grill, fish for a healthy treat or a selection of deliciously cooked vegetables. With plenty of room on the stone, the stone is kept sizzling hot during dining and allows you and your guests plenty of time to sizzle and cook the meal just the way they like it. With no need for oil or fat, cooking on a hot stone is a healthy way to enjoy elegant and enjoyable dining. Stone is handwash only (ensure the stone is completely cool before washing). Wipe clean all other parts once cool. 5 year guarantee. Set includes: 1 x marble stone, 1 x wire stone holder, 1 x wire stand, 1 x wooden base and 2 x burners. Size: 15cm x 22cm x 41.5cm \/ 6\" x 8½\" x 16\" Requires chafer gel (not included). Gift boxed","published_at":"2021-02-17T01:08:00+00:00","created_at":"2017-11-23T14:11:48+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","The Entertainer","The Hostess"],"price":5495,"price_min":5495,"price_max":5495,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4996122050596,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTSTONEGRILL","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"ArtesàNatural Marble Hot Stone Grill (k808)","public_title":null,"options":["Default Title"],"price":5495,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250590008","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/hotstonegrill..jpg?v=1637419260","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/hotstonegrill_1.jpg?v=1637418748","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTSTONEGRILL_10stonegrill.jpg?v=1637418748"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/hotstonegrill..jpg?v=1637419260","options":["Title"],"media":[{"alt":null,"id":21223714127908,"position":1,"preview_image":{"aspect_ratio":1.502,"height":466,"width":700,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/hotstonegrill..jpg?v=1637419260"},"aspect_ratio":1.502,"height":466,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/hotstonegrill..jpg?v=1637419260","width":700},{"alt":null,"id":21193963241508,"position":2,"preview_image":{"aspect_ratio":1.548,"height":420,"width":650,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/hotstonegrill_1.jpg?v=1637418748"},"aspect_ratio":1.548,"height":420,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/hotstonegrill_1.jpg?v=1637418748","width":650},{"alt":null,"id":8032059326500,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTSTONEGRILL_10stonegrill.jpg?v=1637418748"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/ARTSTONEGRILL_10stonegrill.jpg?v=1637418748","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"This hot stone grill allows two or more diners to enjoy the sizzling sensation of cooking on the rock! Big enough for a selection of cuts, whether that's all meat for a posh mixed grill, fish for a healthy treat or a selection of deliciously cooked vegetables. With plenty of room on the stone, the stone is kept sizzling hot during dining and allows you and your guests plenty of time to sizzle and cook the meal just the way they like it. With no need for oil or fat, cooking on a hot stone is a healthy way to enjoy elegant and enjoyable dining. Stone is handwash only (ensure the stone is completely cool before washing). Wipe clean all other parts once cool. 5 year guarantee. Set includes: 1 x marble stone, 1 x wire stone holder, 1 x wire stand, 1 x wooden base and 2 x burners. Size: 15cm x 22cm x 41.5cm \/ 6\" x 8½\" x 16\" Requires chafer gel (not included). Gift boxed"}
ArtesàNatural Marble Hot Stone Grill (k808)

ArtesàNatural Marble Hot Stone Grill (k808)

€54.95

This hot stone grill allows two or more diners to enjoy the sizzling sensation of cooking on the rock! Big enough for a selection of cuts, whether that's all meat for a posh mixed grill, fish for a healthy treat or a selection of deliciously cooked vegetables. With plenty of room on the stone, the stone is kept sizzling hot during dining and all...


More Info
{"id":1449396928548,"title":"Bar Craft Lazy Fish Corkscrew (K008)","handle":"bar-craft-lazy-fish-corkscrew","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eWith a concertina mechanism for easy cork removal of even the most stubborn corks, this lazy fish corkscrew is based of an early 1900's design and uses a unique and innovative way of opening a bottle of wine! The lazyfish mechanism requires the minimum of effort to remove even the most stubborn of corks. The action finishes with a satisfying pop!  Wipe clean only. 5 year guarantee.\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2021-05-13T11:59:28+01:00","created_at":"2019-07-03T22:47:55+01:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":2295,"price_min":2295,"price_max":2295,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":11647059689508,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCLAZYFISH","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Bar Craft Lazy Fish Corkscrew (K008)","public_title":null,"options":["Default Title"],"price":2295,"weight":0,"compare_at_price":null,"inventory_quantity":8,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250673008","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCLAZYFISH_lasy_fish_corkscrew_1.jpg?v=1638017218","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCLAZYFISH_lasy_fish_corkscrew_2.jpg?v=1638017218","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCLAZYFISH_lasy_fish_corkscrew_3.jpg?v=1638017218"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCLAZYFISH_lasy_fish_corkscrew_1.jpg?v=1638017218","options":["Title"],"media":[{"alt":null,"id":21270435659812,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCLAZYFISH_lasy_fish_corkscrew_1.jpg?v=1638017218"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCLAZYFISH_lasy_fish_corkscrew_1.jpg?v=1638017218","width":500},{"alt":null,"id":2495038455844,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCLAZYFISH_lasy_fish_corkscrew_2.jpg?v=1638017218"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCLAZYFISH_lasy_fish_corkscrew_2.jpg?v=1638017218","width":500},{"alt":null,"id":2495038488612,"position":3,"preview_image":{"aspect_ratio":1.0,"height":1417,"width":1417,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCLAZYFISH_lasy_fish_corkscrew_3.jpg?v=1638017218"},"aspect_ratio":1.0,"height":1417,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCLAZYFISH_lasy_fish_corkscrew_3.jpg?v=1638017218","width":1417}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eWith a concertina mechanism for easy cork removal of even the most stubborn corks, this lazy fish corkscrew is based of an early 1900's design and uses a unique and innovative way of opening a bottle of wine! The lazyfish mechanism requires the minimum of effort to remove even the most stubborn of corks. The action finishes with a satisfying pop!  Wipe clean only. 5 year guarantee.\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
Bar Craft Lazy Fish Corkscrew (K008)

Bar Craft Lazy Fish Corkscrew (K008)

€22.95

With a concertina mechanism for easy cork removal of even the most stubborn corks, this lazy fish corkscrew is based of an early 1900's design and uses a unique and innovative way of opening a bottle of wine! The lazyfish mechanism requires the minimum of effort to remove even the most stubborn of corks. The action finishes with a satisfying p...


More Info
{"id":1449412624420,"title":"Bar Craft Wine Aerator (K711)","handle":"bar-craft-wine-aerator","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eGood things come to those who wait. That's especially true when it comes to letting your wine breathe. But if you didn't have to wait, you probably wouldn't. With BarCraft's Plastic Wine Aerator you can cut straight to enjoying your wine's full flavour without the wait! This clever contraption works in really simple way. Pour in your wine, straight from the bottle. The wine aerator exposes it to oxygen as it flows through - instantly bringing out a depth of flavour you'd usually have to wait hours for if you decanted it. It's ideal for serving aged reds, some whites and even vintage ports. The 16-hole design catches any cork or wine sediment, so rather than a mouthful of grit, you can savour a smooth, harmonious blend of fruity notes! 12 month guarantee. Dishwasher safe\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2020-11-28T01:28:18+00:00","created_at":"2019-07-03T23:10:01+01:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":2350,"price_min":2350,"price_max":2350,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":11647105105956,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"bcaerpl","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Bar Craft Wine Aerator (K711)","public_title":null,"options":["Default Title"],"price":2350,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250742711","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCAERPL_wine_aerator.jpg?v=1562191852","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCAERPL_wine_aerator_2.jpg?v=1562191852"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCAERPL_wine_aerator.jpg?v=1562191852","options":["Title"],"media":[{"alt":null,"id":2495055364132,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCAERPL_wine_aerator.jpg?v=1562191852"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCAERPL_wine_aerator.jpg?v=1562191852","width":500},{"alt":null,"id":2495055331364,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCAERPL_wine_aerator_2.jpg?v=1562191852"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCAERPL_wine_aerator_2.jpg?v=1562191852","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eGood things come to those who wait. That's especially true when it comes to letting your wine breathe. But if you didn't have to wait, you probably wouldn't. With BarCraft's Plastic Wine Aerator you can cut straight to enjoying your wine's full flavour without the wait! This clever contraption works in really simple way. Pour in your wine, straight from the bottle. The wine aerator exposes it to oxygen as it flows through - instantly bringing out a depth of flavour you'd usually have to wait hours for if you decanted it. It's ideal for serving aged reds, some whites and even vintage ports. The 16-hole design catches any cork or wine sediment, so rather than a mouthful of grit, you can savour a smooth, harmonious blend of fruity notes! 12 month guarantee. Dishwasher safe\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
Bar Craft Wine Aerator (K711)

Bar Craft Wine Aerator (K711)

€23.50

Good things come to those who wait. That's especially true when it comes to letting your wine breathe. But if you didn't have to wait, you probably wouldn't. With BarCraft's Plastic Wine Aerator you can cut straight to enjoying your wine's full flavour without the wait! This clever contraption works in really simple way. Pour in your wine, ...


More Info
Sale
Barcraft 5 Piece Cocktail Tool Set (K28C)
{"id":386041741348,"title":"Barcraft 5 Piece Cocktail Tool Set (K28C)","handle":"luxe-lounge-5-piece-cocktail-tool-set","description":"This cocktail tool set contains everything you need to create the perfect cocktails right from the comfort of your own home, essential for serving a range of exquisite cocktails. Featuring inspirational recipes on the reverse, including Dry Martini, Caipirinha, Pina Colada and Mojito. Follow a recipe or use the tools to invent a refreshing drink. Set comprises: cocktail strainer, bottle opener, bar knife, stainless steel stand with clearly marked recipes on reverse. Gift boxed. Dishwasher safe. 12 month guarantee.","published_at":"2021-05-13T12:17:05+01:00","created_at":"2017-11-23T09:05:51+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":995,"price_min":995,"price_max":995,"available":true,"price_varies":false,"compare_at_price":1995,"compare_at_price_min":1995,"compare_at_price_max":1995,"compare_at_price_varies":false,"variants":[{"id":4992135397412,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCLLTOOL5PC","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Barcraft 5 Piece Cocktail Tool Set (K28C)","public_title":null,"options":["Default Title"],"price":995,"weight":0,"compare_at_price":1995,"inventory_quantity":11,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250427328","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cocktailbartoolset..jpg?v=1636899758","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cocktailbartoolset...jpg?v=1636899773","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cocktailbartoolset.._da09b045-7e19-497a-90bf-ccef96d20588.jpg?v=1636899786","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cocktailbartoolset._a883f703-5ae8-4508-8d89-4bbc8bf4e444.jpg?v=1636899719"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cocktailbartoolset..jpg?v=1636899758","options":["Title"],"media":[{"alt":null,"id":21188048420900,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cocktailbartoolset..jpg?v=1636899758"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cocktailbartoolset..jpg?v=1636899758","width":700},{"alt":null,"id":21188048453668,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cocktailbartoolset...jpg?v=1636899773"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cocktailbartoolset...jpg?v=1636899773","width":600},{"alt":null,"id":21188048486436,"position":3,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cocktailbartoolset.._da09b045-7e19-497a-90bf-ccef96d20588.jpg?v=1636899786"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cocktailbartoolset.._da09b045-7e19-497a-90bf-ccef96d20588.jpg?v=1636899786","width":600},{"alt":null,"id":21188048519204,"position":4,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cocktailbartoolset._a883f703-5ae8-4508-8d89-4bbc8bf4e444.jpg?v=1636899719"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cocktailbartoolset._a883f703-5ae8-4508-8d89-4bbc8bf4e444.jpg?v=1636899719","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"This cocktail tool set contains everything you need to create the perfect cocktails right from the comfort of your own home, essential for serving a range of exquisite cocktails. Featuring inspirational recipes on the reverse, including Dry Martini, Caipirinha, Pina Colada and Mojito. Follow a recipe or use the tools to invent a refreshing drink. Set comprises: cocktail strainer, bottle opener, bar knife, stainless steel stand with clearly marked recipes on reverse. Gift boxed. Dishwasher safe. 12 month guarantee."}
Barcraft 5 Piece Cocktail Tool Set (K28C)

Barcraft 5 Piece Cocktail Tool Set (K28C)

€9.95

This cocktail tool set contains everything you need to create the perfect cocktails right from the comfort of your own home, essential for serving a range of exquisite cocktails. Featuring inspirational recipes on the reverse, including Dry Martini, Caipirinha, Pina Colada and Mojito. Follow a recipe or use the tools to invent a refreshing drink...


More Info
{"id":6618080018468,"title":"BarCraft Brandy \u0026 Cognac Warmer Gift Set (K281)","handle":"barcraft-brandy-cognac-warmer-gift-set","description":"Create the perfect moment, relaxing with a warm glass of brandy. The only gift any brandy lover needs includes a snifter brandy glass, chrome stand and glass tealight holder. Pour a generous measure of your favourite brandy and place in the stand allowing the candle flame to gently warm your brandy to the perfect temperature. Then sit back and enjoy. 350ml capacity snifter glass.  Chrome warming stand.  Glass tealight holder. Candle not included. Glass is handwash only. Stand and tealight holder are wipe clean only","published_at":"2021-05-17T22:18:31+01:00","created_at":"2021-05-17T22:17:17+01:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":1995,"price_min":1995,"price_max":1995,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39416994725924,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCBWARMER","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Brandy \u0026 Cognac Warmer Gift Set (K281)","public_title":null,"options":["Default Title"],"price":1995,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250849281","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCBWARMERbrandycognacwarmer.jpg?v=1621286305","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCBWARMER_10brandycognacwarmer.jpg?v=1621286305","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCBWARMER_22brandycognacwarmer.jpg?v=1621286305"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCBWARMERbrandycognacwarmer.jpg?v=1621286305","options":["Title"],"media":[{"alt":null,"id":20482144895012,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCBWARMERbrandycognacwarmer.jpg?v=1621286305"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCBWARMERbrandycognacwarmer.jpg?v=1621286305","width":500},{"alt":null,"id":20482144927780,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCBWARMER_10brandycognacwarmer.jpg?v=1621286305"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCBWARMER_10brandycognacwarmer.jpg?v=1621286305","width":500},{"alt":null,"id":20482144960548,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCBWARMER_22brandycognacwarmer.jpg?v=1621286305"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCBWARMER_22brandycognacwarmer.jpg?v=1621286305","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Create the perfect moment, relaxing with a warm glass of brandy. The only gift any brandy lover needs includes a snifter brandy glass, chrome stand and glass tealight holder. Pour a generous measure of your favourite brandy and place in the stand allowing the candle flame to gently warm your brandy to the perfect temperature. Then sit back and enjoy. 350ml capacity snifter glass.  Chrome warming stand.  Glass tealight holder. Candle not included. Glass is handwash only. Stand and tealight holder are wipe clean only"}
BarCraft Brandy & Cognac Warmer Gift Set (K281)

BarCraft Brandy & Cognac Warmer Gift Set (K281)

€19.95

Create the perfect moment, relaxing with a warm glass of brandy. The only gift any brandy lover needs includes a snifter brandy glass, chrome stand and glass tealight holder. Pour a generous measure of your favourite brandy and place in the stand allowing the candle flame to gently warm your brandy to the perfect temperature. Then sit back and e...


More Info
{"id":6618076971044,"title":"BarCraft Champagne \u0026 Prosecco Opener (K720)","handle":"barcraft-champagne-prosecco-opener","description":"Stainless steel opener slides easily over corks creating a secure hold when opening sparkling wines. By holding the cork firmly you are able to twist the bottle to slowly release the cork without wasting a drop. Solid stainless steel construction.  Dishwasher safe","published_at":"2021-05-17T22:16:37+01:00","created_at":"2021-05-17T22:14:58+01:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":750,"price_min":750,"price_max":750,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39416992071716,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCCHAMOP","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Champagne \u0026 Prosecco Opener (K720)","public_title":null,"options":["Default Title"],"price":750,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250818720","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCCHAMOPchampagneproseccoopener.jpg?v=1621286159","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCCHAMOP_20champagneproseccoopener.jpg?v=1621286159"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCCHAMOPchampagneproseccoopener.jpg?v=1621286159","options":["Title"],"media":[{"alt":null,"id":20482137063460,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCCHAMOPchampagneproseccoopener.jpg?v=1621286159"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCCHAMOPchampagneproseccoopener.jpg?v=1621286159","width":500},{"alt":null,"id":20482137096228,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCCHAMOP_20champagneproseccoopener.jpg?v=1621286159"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCCHAMOP_20champagneproseccoopener.jpg?v=1621286159","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Stainless steel opener slides easily over corks creating a secure hold when opening sparkling wines. By holding the cork firmly you are able to twist the bottle to slowly release the cork without wasting a drop. Solid stainless steel construction.  Dishwasher safe"}
BarCraft Champagne & Prosecco Opener (K720)

BarCraft Champagne & Prosecco Opener (K720)

€7.50

Stainless steel opener slides easily over corks creating a secure hold when opening sparkling wines. By holding the cork firmly you are able to twist the bottle to slowly release the cork without wasting a drop. Solid stainless steel construction.  Dishwasher safe


More Info
{"id":6842859028516,"title":"BarCraft Champagne \u0026 Sparkling Wine Stopper","handle":"barcraft-champagne-sparkling-wine-stopper","description":"BarCraft lever-arm stopper with a mirror polished finish to fit most wine and champagne bottles, keeping them fresher for longer. Handwash only","published_at":"2021-12-13T22:18:11+00:00","created_at":"2021-11-30T23:43:27+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":795,"price_min":795,"price_max":795,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39769271369764,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCCHAMSTOP","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Champagne \u0026 Sparkling Wine Stopper","public_title":null,"options":["Default Title"],"price":795,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250125057","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/champagneandsparklingwinestopper1.jpg?v=1638315972","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/champagneandsparklingwinestopper.jpg?v=1638316021"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/champagneandsparklingwinestopper1.jpg?v=1638315972","options":["Title"],"media":[{"alt":null,"id":21290165731364,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/champagneandsparklingwinestopper1.jpg?v=1638315972"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/champagneandsparklingwinestopper1.jpg?v=1638315972","width":700},{"alt":null,"id":21290165764132,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/champagneandsparklingwinestopper.jpg?v=1638316021"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/champagneandsparklingwinestopper.jpg?v=1638316021","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"BarCraft lever-arm stopper with a mirror polished finish to fit most wine and champagne bottles, keeping them fresher for longer. Handwash only"}
BarCraft Champagne & Sparkling Wine Stopper

BarCraft Champagne & Sparkling Wine Stopper

€7.95

BarCraft lever-arm stopper with a mirror polished finish to fit most wine and champagne bottles, keeping them fresher for longer. Handwash only


More Info
{"id":386622160932,"title":"BarCraft Deluxe Lever-Arm Corkscrew Set (K032)","handle":"barcraft-deluxe-lever-arm-corkscrew-set","description":"Are there any more enticing sounds than the pop of a cork leaving a bottle, and the glug of your favourite wine as it pours into a glass? You can't beat a glass of red, white or rose with a meal or when you’re hosting a party or gathering, especially when it's the festive season. But no one enjoys grappling with stubborn, fiddly corkscrews when empty glasses are waiting to be filled. Start popping corks in record times - three seconds to be exact - with this magnificent wine bottle opener with a velvety black body and gleaming brass finish. Made from a heavy duty metal alloy, it'll hold your wine bottle firmly in place as you pull out the cork with a gentle squeeze of the lever arms. This wine bottle corker comes with a twist-action foil cutter, and has its own integral stand, meaning you can keep it to hand (and on display...) in your kitchen or dining area. it's a key element of the elegant BarCraft range from KitchenCraft, a selection of quality bar-standard accessories that let you build your own home bar collection.  Its beautifully gift boxed, too, and makes a great present. Don't just treat yourself... Wipe clean only.","published_at":"2021-05-13T11:55:41+01:00","created_at":"2017-11-23T14:44:40+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","WINE \u0026 BAR"],"price":1995,"price_min":1995,"price_max":1995,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4996436197412,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCCSCREWBRA","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Deluxe Lever-Arm Corkscrew Set (K032)","public_title":null,"options":["Default Title"],"price":1995,"weight":0,"compare_at_price":null,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250713032","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/leverarmcorkscrew._1.jpg?v=1636237507","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/leverarmcorkscrew.jpg?v=1636237483","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/leverarmcorkscrew.._1.jpg?v=1636237523"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/leverarmcorkscrew._1.jpg?v=1636237507","options":["Title"],"media":[{"alt":null,"id":21135323136036,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/leverarmcorkscrew._1.jpg?v=1636237507"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/leverarmcorkscrew._1.jpg?v=1636237507","width":600},{"alt":null,"id":21135313403940,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/leverarmcorkscrew.jpg?v=1636237483"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/leverarmcorkscrew.jpg?v=1636237483","width":500},{"alt":null,"id":21135323168804,"position":3,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/leverarmcorkscrew.._1.jpg?v=1636237523"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/leverarmcorkscrew.._1.jpg?v=1636237523","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Are there any more enticing sounds than the pop of a cork leaving a bottle, and the glug of your favourite wine as it pours into a glass? You can't beat a glass of red, white or rose with a meal or when you’re hosting a party or gathering, especially when it's the festive season. But no one enjoys grappling with stubborn, fiddly corkscrews when empty glasses are waiting to be filled. Start popping corks in record times - three seconds to be exact - with this magnificent wine bottle opener with a velvety black body and gleaming brass finish. Made from a heavy duty metal alloy, it'll hold your wine bottle firmly in place as you pull out the cork with a gentle squeeze of the lever arms. This wine bottle corker comes with a twist-action foil cutter, and has its own integral stand, meaning you can keep it to hand (and on display...) in your kitchen or dining area. it's a key element of the elegant BarCraft range from KitchenCraft, a selection of quality bar-standard accessories that let you build your own home bar collection.  Its beautifully gift boxed, too, and makes a great present. Don't just treat yourself... Wipe clean only."}
BarCraft Deluxe Lever-Arm Corkscrew Set (K032)

BarCraft Deluxe Lever-Arm Corkscrew Set (K032)

€19.95

Are there any more enticing sounds than the pop of a cork leaving a bottle, and the glug of your favourite wine as it pours into a glass? You can't beat a glass of red, white or rose with a meal or when you’re hosting a party or gathering, especially when it's the festive season. But no one enjoys grappling with stubborn, fiddly corkscrews whe...


More Info
{"id":384837910564,"title":"Barcraft Deluxe Wine Decanting Funnel (K629)","handle":"decanting-funnel","description":"Connoisseur deluxe stylish and durable stainless steel decanting funnel, complete with an aerating nozzle, removable fine mesh filter, decanting stand, and drip tray, for effective and easy decanting time and again. Dishwasher safe. Gift boxed.","published_at":"2020-11-04T11:25:12+00:00","created_at":"2017-11-22T10:29:46+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":2295,"price_min":2295,"price_max":2295,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4983702159396,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"kcbcfunnel","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Barcraft Deluxe Wine Decanting Funnel (K629)","public_title":null,"options":["Default Title"],"price":2295,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250135629","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kitchencraftdecantingfunnel_2.jpg?v=1636465238","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kitchencraftdecantingfunnel._1.jpg?v=1636465098","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kitchencraftdecantingfunnel_1.jpg?v=1636465112"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kitchencraftdecantingfunnel_2.jpg?v=1636465238","options":["Title"],"media":[{"alt":null,"id":21147092025380,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kitchencraftdecantingfunnel_2.jpg?v=1636465238"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kitchencraftdecantingfunnel_2.jpg?v=1636465238","width":600},{"alt":null,"id":21147085701156,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kitchencraftdecantingfunnel._1.jpg?v=1636465098"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kitchencraftdecantingfunnel._1.jpg?v=1636465098","width":500},{"alt":null,"id":21147085733924,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kitchencraftdecantingfunnel_1.jpg?v=1636465112"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kitchencraftdecantingfunnel_1.jpg?v=1636465112","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Connoisseur deluxe stylish and durable stainless steel decanting funnel, complete with an aerating nozzle, removable fine mesh filter, decanting stand, and drip tray, for effective and easy decanting time and again. Dishwasher safe. Gift boxed."}
Barcraft Deluxe Wine Decanting Funnel (K629)

Barcraft Deluxe Wine Decanting Funnel (K629)

€22.95

Connoisseur deluxe stylish and durable stainless steel decanting funnel, complete with an aerating nozzle, removable fine mesh filter, decanting stand, and drip tray, for effective and easy decanting time and again. Dishwasher safe. Gift boxed.


More Info
{"id":5058148859940,"title":"BarCraft Flexible Shape Ice Cube Tray, Heart (K887)","handle":"barcraft-flexible-shape-ice-cube-tray-heart","description":"BarCraft flexible novelty ice cube tray for making 14 beautiful heart shaped ice cubes to add a decorative touch to your cool drinks. Simply flex the tray to easily release the cubes. Ideal for birthday and hen parties. Handwash only. Flexible. Size: Makes 14 ice cubes. Tray size: 11cm x 22cm","published_at":"2021-04-07T08:15:48+01:00","created_at":"2021-02-14T23:26:07+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":525,"price_min":525,"price_max":525,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32627813744676,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCICEHEART","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Flexible Shape Ice Cube Tray, Heart (K887)","public_title":null,"options":["Default Title"],"price":525,"weight":0,"compare_at_price":null,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250139887","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCBCICEHEARThearticetray.jpg?v=1613345305"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCBCICEHEARThearticetray.jpg?v=1613345305","options":["Title"],"media":[{"alt":null,"id":8032700727332,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCBCICEHEARThearticetray.jpg?v=1613345305"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCBCICEHEARThearticetray.jpg?v=1613345305","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"BarCraft flexible novelty ice cube tray for making 14 beautiful heart shaped ice cubes to add a decorative touch to your cool drinks. Simply flex the tray to easily release the cubes. Ideal for birthday and hen parties. Handwash only. Flexible. Size: Makes 14 ice cubes. Tray size: 11cm x 22cm"}
BarCraft Flexible Shape Ice Cube Tray, Heart (K887)

BarCraft Flexible Shape Ice Cube Tray, Heart (K887)

€5.25

BarCraft flexible novelty ice cube tray for making 14 beautiful heart shaped ice cubes to add a decorative touch to your cool drinks. Simply flex the tray to easily release the cubes. Ideal for birthday and hen parties. Handwash only. Flexible. Size: Makes 14 ice cubes. Tray size: 11cm x 22cm


More Info
{"id":383775572004,"title":"Barcraft Rotary Action Acrylic Ice Crusher (k004)","handle":"rotary-action-acrylic-ice-crusher","description":"BarCraft deluxe retro style ice crusher with an easy to use rotary action, large clear acrylic collecting box and matching ice scoop. Create crushed ice as and when you need it to serve perfectly cool drinks and cocktails. Everyday essentials for the bar at home, BarCraft offers a selection of bar essentials to bring the fun inside your home. Covering wine, cocktails, spirits and so much more, BarCraft is the perfect choice when wanting to relax at home, feeling refreshed and revitalised. Handwash only\u003cbr\u003e\u003cbr\u003e","published_at":"2020-11-05T12:34:16+00:00","created_at":"2017-11-21T17:05:08+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":4795,"price_min":4795,"price_max":4795,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4975463399460,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCICECR","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Barcraft Rotary Action Acrylic Ice Crusher (k004)","public_title":null,"options":["Default Title"],"price":4795,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250150004","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/icecrusher.jpg?v=1636753003","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kitchencrafticecrusher.jpg?v=1636753023"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/icecrusher.jpg?v=1636753003","options":["Title"],"media":[{"alt":null,"id":21173632729124,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/icecrusher.jpg?v=1636753003"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/icecrusher.jpg?v=1636753003","width":600},{"alt":null,"id":21173632696356,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kitchencrafticecrusher.jpg?v=1636753023"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kitchencrafticecrusher.jpg?v=1636753023","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"BarCraft deluxe retro style ice crusher with an easy to use rotary action, large clear acrylic collecting box and matching ice scoop. Create crushed ice as and when you need it to serve perfectly cool drinks and cocktails. Everyday essentials for the bar at home, BarCraft offers a selection of bar essentials to bring the fun inside your home. Covering wine, cocktails, spirits and so much more, BarCraft is the perfect choice when wanting to relax at home, feeling refreshed and revitalised. Handwash only\u003cbr\u003e\u003cbr\u003e"}
Barcraft Rotary Action Acrylic Ice Crusher (k004)

Barcraft Rotary Action Acrylic Ice Crusher (k004)

€47.95

BarCraft deluxe retro style ice crusher with an easy to use rotary action, large clear acrylic collecting box and matching ice scoop. Create crushed ice as and when you need it to serve perfectly cool drinks and cocktails. Everyday essentials for the bar at home, BarCraft offers a selection of bar essentials to bring the fun inside your home. Co...


More Info
{"id":1449410592804,"title":"BarCraft Shot Measure \u0026 Pourer (k481)","handle":"bar-craft-shot-measure-pourer","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eAn essential for mixing cocktails and drinks, this BarCraft shot measure and pourer provides a single shot measure and attaches easily to any bottle top. A must-have bar accessory.\u003cspan\u003e \u003c\/span\u003eHandwash only. 12 month guarantee\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2021-05-13T12:05:35+01:00","created_at":"2019-07-03T23:06:09+01:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","WINE \u0026 BAR"],"price":795,"price_min":795,"price_max":795,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":11647100125220,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"kcbcshot","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Shot Measure \u0026 Pourer (k481)","public_title":null,"options":["Default Title"],"price":795,"weight":0,"compare_at_price":null,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250139481","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kcbcshot_shot_measure.jpg?v=1562191640"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kcbcshot_shot_measure.jpg?v=1562191640","options":["Title"],"media":[{"alt":null,"id":2495052578852,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kcbcshot_shot_measure.jpg?v=1562191640"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/kcbcshot_shot_measure.jpg?v=1562191640","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eAn essential for mixing cocktails and drinks, this BarCraft shot measure and pourer provides a single shot measure and attaches easily to any bottle top. A must-have bar accessory.\u003cspan\u003e \u003c\/span\u003eHandwash only. 12 month guarantee\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
BarCraft Shot Measure & Pourer (k481)

BarCraft Shot Measure & Pourer (k481)

€7.95

An essential for mixing cocktails and drinks, this BarCraft shot measure and pourer provides a single shot measure and attaches easily to any bottle top. A must-have bar accessory. Handwash only. 12 month guarantee


More Info
{"id":383775408164,"title":"Barcraft Stainless Steel Ice Serving Tongs (k54a)","handle":"stainless-steel-ice-serving-tongs","description":"Deluxe brushed stainless steel ice serving tongs, with ridged edges for a secure grip on slippery ice. Ideal for use with ice buckets. Dishwasher safe.","published_at":"2020-11-05T12:25:09+00:00","created_at":"2017-11-21T17:05:00+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":395,"price_min":395,"price_max":395,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4975462580260,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCTONGS","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Barcraft Stainless Steel Ice Serving Tongs (k54a)","public_title":null,"options":["Default Title"],"price":395,"weight":0,"compare_at_price":null,"inventory_quantity":4,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250144454","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/stainlesssteelicetongs.jpg?v=1636753306"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/stainlesssteelicetongs.jpg?v=1636753306","options":["Title"],"media":[{"alt":null,"id":21173664415780,"position":1,"preview_image":{"aspect_ratio":1.0,"height":637,"width":637,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/stainlesssteelicetongs.jpg?v=1636753306"},"aspect_ratio":1.0,"height":637,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/stainlesssteelicetongs.jpg?v=1636753306","width":637}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Deluxe brushed stainless steel ice serving tongs, with ridged edges for a secure grip on slippery ice. Ideal for use with ice buckets. Dishwasher safe."}
Barcraft Stainless Steel Ice Serving Tongs (k54a)

Barcraft Stainless Steel Ice Serving Tongs (k54a)

€3.95

Deluxe brushed stainless steel ice serving tongs, with ridged edges for a secure grip on slippery ice. Ideal for use with ice buckets. Dishwasher safe.


More Info
{"id":4607597445156,"title":"BarCraft Stainless Steel Wine Pourer with Stopper (kc13d)","handle":"barcraft-stainless-steel-wine-pourer-with-stopper","description":"Stylish, two in one stainless steel bottle pourer to stop dripping wine and a removable bottle stopper to keep wine fresh when not in use. Fits most wine bottles. Handwash only. 12 month guarantee","published_at":"2021-05-13T12:03:45+01:00","created_at":"2020-04-25T14:42:13+01:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":495,"price_min":495,"price_max":495,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":31891406323748,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCPOURCD","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Stainless Steel Wine Pourer with Stopper (kc13d)","public_title":null,"options":["Default Title"],"price":495,"weight":0,"compare_at_price":null,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250148513","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCBCPOURCDwinepourerandstopper2.jpg?v=1587822190","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCBCPOURCDwinepourerandstopper.jpg?v=1587822190"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCBCPOURCDwinepourerandstopper2.jpg?v=1587822190","options":["Title"],"media":[{"alt":null,"id":6667989221412,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCBCPOURCDwinepourerandstopper2.jpg?v=1587822190"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCBCPOURCDwinepourerandstopper2.jpg?v=1587822190","width":500},{"alt":null,"id":6667989254180,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCBCPOURCDwinepourerandstopper.jpg?v=1587822190"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCBCPOURCDwinepourerandstopper.jpg?v=1587822190","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Stylish, two in one stainless steel bottle pourer to stop dripping wine and a removable bottle stopper to keep wine fresh when not in use. Fits most wine bottles. Handwash only. 12 month guarantee"}
BarCraft Stainless Steel Wine Pourer with Stopper (kc13d)

BarCraft Stainless Steel Wine Pourer with Stopper (kc13d)

€4.95

Stylish, two in one stainless steel bottle pourer to stop dripping wine and a removable bottle stopper to keep wine fresh when not in use. Fits most wine bottles. Handwash only. 12 month guarantee


More Info
{"id":383774162980,"title":"Barcraft Wine Bottle Thermometer Sleeve (k79a)","handle":"wine-bottle-thermometer-sleeve","description":"Bar Craft easy to use wine thermometer and guide. Simply slip the thermometer sleeve over the bottle and the temperature lights up on the sleeve. Suitable for red and white wine, with suggested temperatures for most wines. Wipe clean only. Gift boxed","published_at":"2020-12-11T12:42:56+00:00","created_at":"2017-11-21T17:03:56+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":895,"price_min":895,"price_max":895,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4975451832356,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCTHERM","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Barcraft Wine Bottle Thermometer Sleeve (k79a)","public_title":null,"options":["Default Title"],"price":895,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250135650","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/Winebottlethermometersleeve_1.jpg?v=1636753411","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/winebottlethermometer_8016b994-92e6-4cf7-b22a-8f189b20719c.jpg?v=1636567186","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/winebottlethermometersleeve..jpg?v=1636567201"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/Winebottlethermometersleeve_1.jpg?v=1636753411","options":["Title"],"media":[{"alt":null,"id":21173686665252,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/Winebottlethermometersleeve_1.jpg?v=1636753411"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/Winebottlethermometersleeve_1.jpg?v=1636753411","width":600},{"alt":null,"id":21157664948260,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/winebottlethermometer_8016b994-92e6-4cf7-b22a-8f189b20719c.jpg?v=1636567186"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/winebottlethermometer_8016b994-92e6-4cf7-b22a-8f189b20719c.jpg?v=1636567186","width":600},{"alt":null,"id":21157664981028,"position":3,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/winebottlethermometersleeve..jpg?v=1636567201"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/winebottlethermometersleeve..jpg?v=1636567201","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Bar Craft easy to use wine thermometer and guide. Simply slip the thermometer sleeve over the bottle and the temperature lights up on the sleeve. Suitable for red and white wine, with suggested temperatures for most wines. Wipe clean only. Gift boxed"}
Barcraft Wine Bottle Thermometer Sleeve (k79a)

Barcraft Wine Bottle Thermometer Sleeve (k79a)

€8.95

Bar Craft easy to use wine thermometer and guide. Simply slip the thermometer sleeve over the bottle and the temperature lights up on the sleeve. Suitable for red and white wine, with suggested temperatures for most wines. Wipe clean only. Gift boxed


More Info
Sale
Bialetti Kitty Induction Cafetiere, 4 Cup (S067)
{"id":4982555836452,"title":"Bialetti Kitty Induction Cafetiere, 4 Cup (S067)","handle":"bialetti-kitty-induction-cafetiere-4-cup","description":"\u003cp\u003eThe Bialetti Kitty produces the same authentic Italian espresso, using the same brewing technique, as the original Moka Express. Offering a contemporary rounded design, this stovetop espresso pot is made from stainless steel and is compatible with all cook tops including induction. A functional style with a practical, drip-less pouring spout, it is c\u003cspan\u003eonstructed from food grade stainless steel and has an ergonomic, soft touch heat-resistant handle and Bialetti’s patented safety valve.\u003c\/span\u003e To produce an authentic espresso in minutes, simply fill the bottom with water add your favourite espresso ground coffee to the funnel and gently heat on your stovetop. \u003cem\u003ePlease note, the cup size refers to an espresso cup. \u003c\/em\u003eMaterial: Stainless Steel. Suitable for Induction.\u003c\/p\u003e","published_at":"2020-11-17T11:32:35+00:00","created_at":"2020-11-17T11:31:51+00:00","vendor":"EA Symmons","type":"","tags":["Bialeti","BIALETTI","Bialetti Dublin","Bialetti Ireland","CAFETIERE","COFFEE MAKER","COFFEE PLUNGER","TABLE \u0026 BAR"],"price":3795,"price_min":3795,"price_max":3795,"available":true,"price_varies":false,"compare_at_price":4795,"compare_at_price_min":4795,"compare_at_price_max":4795,"compare_at_price_varies":false,"variants":[{"id":32473842876452,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Bialetti Kitty Induction Cafetiere, 4 Cup (S067)","public_title":null,"options":["Default Title"],"price":3795,"weight":0,"compare_at_price":4795,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"8006363018067","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/Bialetti_Kitty_xaa_4235abbd-4a6f-41ce-9f24-a0374061cb03.jpg?v=1605612712"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/Bialetti_Kitty_xaa_4235abbd-4a6f-41ce-9f24-a0374061cb03.jpg?v=1605612712","options":["Title"],"media":[{"alt":null,"id":7651229466660,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/Bialetti_Kitty_xaa_4235abbd-4a6f-41ce-9f24-a0374061cb03.jpg?v=1605612712"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/Bialetti_Kitty_xaa_4235abbd-4a6f-41ce-9f24-a0374061cb03.jpg?v=1605612712","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eThe Bialetti Kitty produces the same authentic Italian espresso, using the same brewing technique, as the original Moka Express. Offering a contemporary rounded design, this stovetop espresso pot is made from stainless steel and is compatible with all cook tops including induction. A functional style with a practical, drip-less pouring spout, it is c\u003cspan\u003eonstructed from food grade stainless steel and has an ergonomic, soft touch heat-resistant handle and Bialetti’s patented safety valve.\u003c\/span\u003e To produce an authentic espresso in minutes, simply fill the bottom with water add your favourite espresso ground coffee to the funnel and gently heat on your stovetop. \u003cem\u003ePlease note, the cup size refers to an espresso cup. \u003c\/em\u003eMaterial: Stainless Steel. Suitable for Induction.\u003c\/p\u003e"}
Bialetti Kitty Induction Cafetiere, 4 Cup (S067)

Bialetti Kitty Induction Cafetiere, 4 Cup (S067)

€37.95

The Bialetti Kitty produces the same authentic Italian espresso, using the same brewing technique, as the original Moka Express. Offering a contemporary rounded design, this stovetop espresso pot is made from stainless steel and is compatible with all cook tops including induction. A functional style with a practical, drip-less pouring spout, it...


More Info
Sale
Bialetti Moka Express Caffettiera/Espresso Maker, 3 Cup (S624)
{"id":386151120932,"title":"Bialetti Moka Express Caffettiera\/Espresso Maker, 3 Cup (S624)","handle":"bialetti-moka-express-caffettiera-espresso-maker-3-cup","description":"The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich, authentic espresso in just minutes. The aluminum pot features Bialetti’s distinctive eight-sided shape that allows it to diffuse heat perfectly to enhance the aroma of your coffee.Moka Express Espresso Maker features: Designed in Italy. Body made from top quality aluminium.Moulded resin handle stays cool during use. Ergonomically designed. Suitable for use on gas, electric and ceramic cooktops. Use on a low flame only, or you'll risk damaging your coffee maker. Hand wash in warm water only. Capacity: 3 Cups. 130ml. 4.4oz","published_at":"2020-11-16T21:08:18+00:00","created_at":"2017-11-23T10:10:47+00:00","vendor":"EA Symmons","type":"","tags":["Bialeti","BIALETTI","Bialetti Dublin","Bialetti Ireland","CAFETIERE","COFFEE MAKER","COFFEE PLUNGER","TABLE \u0026 BAR"],"price":2995,"price_min":2995,"price_max":2995,"available":true,"price_varies":false,"compare_at_price":3995,"compare_at_price_min":3995,"compare_at_price_max":3995,"compare_at_price_varies":false,"variants":[{"id":4992661487652,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"1162","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Bialetti Moka Express Caffettiera\/Espresso Maker, 3 Cup (S624)","public_title":null,"options":["Default Title"],"price":2995,"weight":0,"compare_at_price":3995,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"8006363011624","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/bialetti_20moka_20express_203_20cup.jpg?v=1511431847"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/bialetti_20moka_20express_203_20cup.jpg?v=1511431847","options":["Title"],"media":[{"alt":null,"id":728075763748,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/bialetti_20moka_20express_203_20cup.jpg?v=1511431847"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/bialetti_20moka_20express_203_20cup.jpg?v=1511431847","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich, authentic espresso in just minutes. The aluminum pot features Bialetti’s distinctive eight-sided shape that allows it to diffuse heat perfectly to enhance the aroma of your coffee.Moka Express Espresso Maker features: Designed in Italy. Body made from top quality aluminium.Moulded resin handle stays cool during use. Ergonomically designed. Suitable for use on gas, electric and ceramic cooktops. Use on a low flame only, or you'll risk damaging your coffee maker. Hand wash in warm water only. Capacity: 3 Cups. 130ml. 4.4oz"}
Bialetti Moka Express Caffettiera/Espresso Maker, 3 Cup (S624)

Bialetti Moka Express Caffettiera/Espresso Maker, 3 Cup (S624)

€29.95

The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich...


More Info
Sale
Bialetti Moka Express Caffettiera/Espresso Maker, 6 Cup (S631)
{"id":386150891556,"title":"Bialetti Moka Express Caffettiera\/Espresso Maker, 6 Cup (S631)","handle":"bialetti-moka-express-caffettiera-espresso-maker-6-cup","description":"The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich, authentic espresso in just minutes. The aluminum pot features Bialetti’s distinctive eight-sided shape that allows it to diffuse heat perfectly to enhance the aroma of your coffee. Moka Express Espresso Maker features: Designed in Italy. Body made from top quality aluminium.Moulded resin handle stays cool during use. Ergonomically designed. Suitable for use on gas, electric and ceramic cooktops. Use on a low flame only, or you'll risk damaging your coffee maker. Hand wash in warm water only. Capacity: 6 Cups. 270ml. 9.1oz","published_at":"2020-11-16T21:08:19+00:00","created_at":"2017-11-23T10:10:42+00:00","vendor":"EA Symmons","type":"","tags":["Bialeti","BIALETTI","Bialetti Dublin","Bialetti Ireland","CAFETIERE","COFFEE MAKER","COFFEE PLUNGER","TABLE \u0026 BAR"],"price":3695,"price_min":3695,"price_max":3695,"available":true,"price_varies":false,"compare_at_price":4695,"compare_at_price_min":4695,"compare_at_price_max":4695,"compare_at_price_varies":false,"variants":[{"id":4992660897828,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"1163","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Bialetti Moka Express Caffettiera\/Espresso Maker, 6 Cup (S631)","public_title":null,"options":["Default Title"],"price":3695,"weight":0,"compare_at_price":4695,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"8006363011631","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/bialetti_20moka_20express_206_20cup.jpg?v=1511431842"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/bialetti_20moka_20express_206_20cup.jpg?v=1511431842","options":["Title"],"media":[{"alt":null,"id":728075632676,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/bialetti_20moka_20express_206_20cup.jpg?v=1511431842"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/bialetti_20moka_20express_206_20cup.jpg?v=1511431842","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich, authentic espresso in just minutes. The aluminum pot features Bialetti’s distinctive eight-sided shape that allows it to diffuse heat perfectly to enhance the aroma of your coffee. Moka Express Espresso Maker features: Designed in Italy. Body made from top quality aluminium.Moulded resin handle stays cool during use. Ergonomically designed. Suitable for use on gas, electric and ceramic cooktops. Use on a low flame only, or you'll risk damaging your coffee maker. Hand wash in warm water only. Capacity: 6 Cups. 270ml. 9.1oz"}
Bialetti Moka Express Caffettiera/Espresso Maker, 6 Cup (S631)

Bialetti Moka Express Caffettiera/Espresso Maker, 6 Cup (S631)

€36.95

The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich...


More Info
Sale
Bialetti Moka Express Caffettiera/Espresso Maker, 9 Cup (S655)
{"id":386150662180,"title":"Bialetti Moka Express Caffettiera\/Espresso Maker, 9 Cup (S655)","handle":"bialetti-moka-express-caffettiera-espresso-maker-9-cup","description":"The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich, authentic espresso in just minutes. The aluminum pot features Bialetti’s distinctive eight-sided shape that allows it to diffuse heat perfectly to enhance the aroma of your coffee.Moka Express Espresso Maker features: Designed in Italy. Body made from top quality aluminium.Moulded resin handle stays cool during use. Ergonomically designed. Suitable for use on gas, electric and ceramic cooktops. Use on a low flame only, or you’ll risk damaging your coffee maker. Hand wash in warm water only. Capacity: 9 Cups.","published_at":"2020-11-16T20:58:44+00:00","created_at":"2017-11-23T10:10:34+00:00","vendor":"EA Symmons","type":"","tags":["Bialeti","BIALETTI","Bialetti Dublin","Bialetti Ireland","CAFETIERE","COFFEE MAKER","COFFEE PLUNGER","TABLE \u0026 BAR"],"price":4995,"price_min":4995,"price_max":4995,"available":true,"price_varies":false,"compare_at_price":5995,"compare_at_price_min":5995,"compare_at_price_max":5995,"compare_at_price_varies":false,"variants":[{"id":4992657883172,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"1165","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Bialetti Moka Express Caffettiera\/Espresso Maker, 9 Cup (S655)","public_title":null,"options":["Default Title"],"price":4995,"weight":0,"compare_at_price":5995,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"8006363011655","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/bialetti_20moka_20express.jpg?v=1511431835"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/bialetti_20moka_20express.jpg?v=1511431835","options":["Title"],"media":[{"alt":null,"id":728075501604,"position":1,"preview_image":{"aspect_ratio":1.0,"height":491,"width":491,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/bialetti_20moka_20express.jpg?v=1511431835"},"aspect_ratio":1.0,"height":491,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/bialetti_20moka_20express.jpg?v=1511431835","width":491}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich, authentic espresso in just minutes. The aluminum pot features Bialetti’s distinctive eight-sided shape that allows it to diffuse heat perfectly to enhance the aroma of your coffee.Moka Express Espresso Maker features: Designed in Italy. Body made from top quality aluminium.Moulded resin handle stays cool during use. Ergonomically designed. Suitable for use on gas, electric and ceramic cooktops. Use on a low flame only, or you’ll risk damaging your coffee maker. Hand wash in warm water only. Capacity: 9 Cups."}
Bialetti Moka Express Caffettiera/Espresso Maker, 9 Cup (S655)

Bialetti Moka Express Caffettiera/Espresso Maker, 9 Cup (S655)

€49.95

The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich...


More Info
{"id":6612731756580,"title":"Brass Finish Stainless Steel Cocktail Shaker, Tropical (k16a)","handle":"brass-finish-stainless-steel-cocktail-shaker-tropical","description":"Capturing the essence of the Tropical Trend, BarCraft’s Tropical Leaves cocktail shaker features an integral strainer lid with brass finish and a sumptuous palm leaf design. The water transfer print method results in rich deep blues and vibrant greens, bringing a more sophisticated tropical feel to the fore. Is there a dinner party looming, and you’re fresh out of ideas for exciting drinks? This luxury shaker includes a recipe to get your party of to a tropical start, a classic Mai Tai is guaranteed to be a crowd pleaser, for every audience. Includes a cocktail recipe. Suitable for producing all shaken cocktails. Made from brass finished stainless steel. 500ml capacity. Integral strainer lid. Handwash only\u003cbr\u003e\u003cbr\u003e","published_at":"2021-05-13T13:18:19+01:00","created_at":"2021-05-13T13:14:46+01:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":2295,"price_min":2295,"price_max":2295,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39410208669732,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCCSPALM","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Brass Finish Stainless Steel Cocktail Shaker, Tropical (k16a)","public_title":null,"options":["Default Title"],"price":2295,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250855916","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCCSPALMbrasscocktailshaker.jpg?v=1620908254","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCCSPALM_20brasscocktailshaker.jpg?v=1620908254"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCCSPALMbrasscocktailshaker.jpg?v=1620908254","options":["Title"],"media":[{"alt":null,"id":20464923672612,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCCSPALMbrasscocktailshaker.jpg?v=1620908254"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCCSPALMbrasscocktailshaker.jpg?v=1620908254","width":500},{"alt":null,"id":20464923705380,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCCSPALM_20brasscocktailshaker.jpg?v=1620908254"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BCCSPALM_20brasscocktailshaker.jpg?v=1620908254","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Capturing the essence of the Tropical Trend, BarCraft’s Tropical Leaves cocktail shaker features an integral strainer lid with brass finish and a sumptuous palm leaf design. The water transfer print method results in rich deep blues and vibrant greens, bringing a more sophisticated tropical feel to the fore. Is there a dinner party looming, and you’re fresh out of ideas for exciting drinks? This luxury shaker includes a recipe to get your party of to a tropical start, a classic Mai Tai is guaranteed to be a crowd pleaser, for every audience. Includes a cocktail recipe. Suitable for producing all shaken cocktails. Made from brass finished stainless steel. 500ml capacity. Integral strainer lid. Handwash only\u003cbr\u003e\u003cbr\u003e"}
Brass Finish Stainless Steel Cocktail Shaker, Tropical (k16a)

Brass Finish Stainless Steel Cocktail Shaker, Tropical (k16a)

€22.95

Capturing the essence of the Tropical Trend, BarCraft’s Tropical Leaves cocktail shaker features an integral strainer lid with brass finish and a sumptuous palm leaf design. The water transfer print method results in rich deep blues and vibrant greens, bringing a more sophisticated tropical feel to the fore. Is there a dinner party looming, and ...


More Info
Sale
Built Double Walled Insulated Drinks Bottle, 17oz, Black (k94a)
{"id":4497338007588,"title":"Built Double Walled Insulated Drinks Bottle, 17oz, Black (k94a)","handle":"built-double-walled-stainless-steel-water-bottle-17oz-black","description":"\u003cspan\u003eThis Hydration water bottle is designed to make staying hydrated and maintaining a healthy lifestyle wherever you go even more appealing. A double walled, vacuum-insulated body is made of 18\/8 stainless steel which insulates cold drinks for up to 24 hours and hot for up to 6 hours, keeping them as fresh as any ‘just-purchased’ option. The double wall also means the exterior will stay a comfortable temperature to hold, while Perfect Seal technology ensures that the lid is leak-proof and will not fail. Perfect for taking water, smoothies or any hot or cold refreshment, this bottle is ideal for taking with you for a nourishing boost in the gym, on the commute or anywhere on the go. The bottle is a cool pastel blue with a stylish matte finish, making it a fashionable piece as well as functional. The bottle is suitable for a standard size cup holder to sit comfortably on car journeys and is BPA free for peace of mind. Capacity: 480ml\/17fl oz.\u003c\/span\u003e","published_at":"2020-11-05T11:38:29+00:00","created_at":"2020-02-06T15:24:19+00:00","vendor":"Kitchencraft","type":"","tags":["chillys","TABLE \u0026 BAR"],"price":1495,"price_min":1495,"price_max":1495,"available":true,"price_varies":false,"compare_at_price":1995,"compare_at_price_min":1995,"compare_at_price_max":1995,"compare_at_price_varies":false,"variants":[{"id":31652531666980,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"5234710","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Built Double Walled Insulated Drinks Bottle, 17oz, Black (k94a)","public_title":null,"options":["Default Title"],"price":1495,"weight":0,"compare_at_price":1995,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5050993328594","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5234710_black_water_bottle_double_walled.jpg?v=1581002675"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5234710_black_water_bottle_double_walled.jpg?v=1581002675","options":["Title"],"media":[{"alt":null,"id":6281506193444,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5234710_black_water_bottle_double_walled.jpg?v=1581002675"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5234710_black_water_bottle_double_walled.jpg?v=1581002675","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cspan\u003eThis Hydration water bottle is designed to make staying hydrated and maintaining a healthy lifestyle wherever you go even more appealing. A double walled, vacuum-insulated body is made of 18\/8 stainless steel which insulates cold drinks for up to 24 hours and hot for up to 6 hours, keeping them as fresh as any ‘just-purchased’ option. The double wall also means the exterior will stay a comfortable temperature to hold, while Perfect Seal technology ensures that the lid is leak-proof and will not fail. Perfect for taking water, smoothies or any hot or cold refreshment, this bottle is ideal for taking with you for a nourishing boost in the gym, on the commute or anywhere on the go. The bottle is a cool pastel blue with a stylish matte finish, making it a fashionable piece as well as functional. The bottle is suitable for a standard size cup holder to sit comfortably on car journeys and is BPA free for peace of mind. Capacity: 480ml\/17fl oz.\u003c\/span\u003e"}
Built Double Walled Insulated Drinks Bottle, 17oz, Black (k94a)

Built Double Walled Insulated Drinks Bottle, 17oz, Black (k94a)

€14.95

This Hydration water bottle is designed to make staying hydrated and maintaining a healthy lifestyle wherever you go even more appealing. A double walled, vacuum-insulated body is made of 18/8 stainless steel which insulates cold drinks for up to 24 hours and hot for up to 6 hours, keeping them as fresh as any ‘just-purchased’ option. The double...


More Info
Sale
Built Double Walled Insulated Drinks Bottle, 17oz, Mustard (k82a)
{"id":4368148529188,"title":"Built Double Walled Insulated Drinks Bottle, 17oz, Mustard (k82a)","handle":"built-double-walled-stainless-steel-water-bottle-17oz-mustard","description":"\u003cdiv class=\"left\"\u003e\u003cspan\u003eThis Hydration water bottle is designed to make staying hydrated and maintaining a healthy lifestyle wherever you go even more appealing. A double walled, vacuum-insulated body is made of 18\/8 stainless steel which insulates cold drinks for up to 24 hours and hot for up to 6 hours, keeping them as fresh as any ‘just-purchased’ option. The double wall also means the exterior will stay a comfortable temperature to hold, while Perfect Seal technology ensures that the lid is leak-proof and will not fail. Perfect for taking water, smoothies or any hot or cold refreshment, this bottle is ideal for taking with you for a nourishing boost in the gym, on the commute or anywhere on the go. The bottle is a chic shade of vanilla with a stylish matte finish, making it a fashionable piece as well as functional. The bottle is suitable for a standard size cup holder to sit comfortably on car journeys and is BPA free for peace of mind. Capacity: 480ml\/17fl oz.\u003c\/span\u003e\u003c\/div\u003e","published_at":"2020-11-05T11:26:28+00:00","created_at":"2019-11-17T21:52:20+00:00","vendor":"Kitchencraft","type":"","tags":["chillys","TABLE \u0026 BAR"],"price":1495,"price_min":1495,"price_max":1495,"available":true,"price_varies":false,"compare_at_price":1995,"compare_at_price_min":1995,"compare_at_price_max":1995,"compare_at_price_varies":false,"variants":[{"id":31227754217508,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"C000422","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Built Double Walled Insulated Drinks Bottle, 17oz, Mustard (k82a)","public_title":null,"options":["Default Title"],"price":1495,"weight":0,"compare_at_price":1995,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5050993348882","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/C000422_mustard_colour_water_bottle.jpg?v=1574027554"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/C000422_mustard_colour_water_bottle.jpg?v=1574027554","options":["Title"],"media":[{"alt":null,"id":5703945650212,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/C000422_mustard_colour_water_bottle.jpg?v=1574027554"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/C000422_mustard_colour_water_bottle.jpg?v=1574027554","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv class=\"left\"\u003e\u003cspan\u003eThis Hydration water bottle is designed to make staying hydrated and maintaining a healthy lifestyle wherever you go even more appealing. A double walled, vacuum-insulated body is made of 18\/8 stainless steel which insulates cold drinks for up to 24 hours and hot for up to 6 hours, keeping them as fresh as any ‘just-purchased’ option. The double wall also means the exterior will stay a comfortable temperature to hold, while Perfect Seal technology ensures that the lid is leak-proof and will not fail. Perfect for taking water, smoothies or any hot or cold refreshment, this bottle is ideal for taking with you for a nourishing boost in the gym, on the commute or anywhere on the go. The bottle is a chic shade of vanilla with a stylish matte finish, making it a fashionable piece as well as functional. The bottle is suitable for a standard size cup holder to sit comfortably on car journeys and is BPA free for peace of mind. Capacity: 480ml\/17fl oz.\u003c\/span\u003e\u003c\/div\u003e"}
Built Double Walled Insulated Drinks Bottle, 17oz, Mustard (k82a)

Built Double Walled Insulated Drinks Bottle, 17oz, Mustard (k82a)

€14.95

This Hydration water bottle is designed to make staying hydrated and maintaining a healthy lifestyle wherever you go even more appealing. A double walled, vacuum-insulated body is made of 18/8 stainless steel which insulates cold drinks for up to 24 hours and hot for up to 6 hours, keeping them as fresh as any ‘just-purchased’ option. The double...


More Info
Sale
Built Double Walled Insulated Drinks Bottle, 17oz, Red (k17a)
{"id":1187523002404,"title":"Built Double Walled Insulated Drinks Bottle, 17oz, Red (k17a)","handle":"built-double-walled-stainless-steel-water-bottle-17oz-red","description":"\u003cspan\u003eThis Hydration water bottle is designed to make staying hydrated and maintaining a healthy lifestyle wherever you go even more appealing, while also reducing your plastic footprint with its reusable design. A double walled, vacuum-insulated body is made of 18\/8 stainless steel which insulates cold drinks for up to 24 hours and hot for up to 6 hours, keeping them as fresh as any ‘just-purchased’ option. The double wall also means the exterior will stay a comfortable temperature to hold, while Perfect Seal technology ensures that the lid is leak-proof and will not fail. Perfect for taking water, smoothies or any hot or cold refreshment, this bottle is ideal for taking with you for a nourishing boost in the gym, on the commute or anywhere on the go. A striking design, this model is visually impressive as well as functional with a sleek shape, glossy red finish and the Built logo etched in silver. The bottle is suitable for a standard size cup holder to sit comfortably on car journeys and is BPA free for peace of mind. Capacity: 480ml\/17fl oz.\u003c\/span\u003e","published_at":"2020-11-05T11:37:51+00:00","created_at":"2019-03-12T14:28:42+00:00","vendor":"Kitchencraft","type":"","tags":["chillys","TABLE \u0026 BAR"],"price":1495,"price_min":1495,"price_max":1495,"available":true,"price_varies":false,"compare_at_price":1995,"compare_at_price_min":1995,"compare_at_price_max":1995,"compare_at_price_varies":false,"variants":[{"id":10548136345636,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"5234712","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Built Double Walled Insulated Drinks Bottle, 17oz, Red (k17a)","public_title":null,"options":["Default Title"],"price":1495,"weight":0,"compare_at_price":1995,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5050993328617","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5234712_red_water_hydration_bottle.jpg?v=1552400944"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5234712_red_water_hydration_bottle.jpg?v=1552400944","options":["Title"],"media":[{"alt":null,"id":2083484074020,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5234712_red_water_hydration_bottle.jpg?v=1552400944"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/5234712_red_water_hydration_bottle.jpg?v=1552400944","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cspan\u003eThis Hydration water bottle is designed to make staying hydrated and maintaining a healthy lifestyle wherever you go even more appealing, while also reducing your plastic footprint with its reusable design. A double walled, vacuum-insulated body is made of 18\/8 stainless steel which insulates cold drinks for up to 24 hours and hot for up to 6 hours, keeping them as fresh as any ‘just-purchased’ option. The double wall also means the exterior will stay a comfortable temperature to hold, while Perfect Seal technology ensures that the lid is leak-proof and will not fail. Perfect for taking water, smoothies or any hot or cold refreshment, this bottle is ideal for taking with you for a nourishing boost in the gym, on the commute or anywhere on the go. A striking design, this model is visually impressive as well as functional with a sleek shape, glossy red finish and the Built logo etched in silver. The bottle is suitable for a standard size cup holder to sit comfortably on car journeys and is BPA free for peace of mind. Capacity: 480ml\/17fl oz.\u003c\/span\u003e"}
Built Double Walled Insulated Drinks Bottle, 17oz, Red (k17a)

Built Double Walled Insulated Drinks Bottle, 17oz, Red (k17a)

€14.95

This Hydration water bottle is designed to make staying hydrated and maintaining a healthy lifestyle wherever you go even more appealing, while also reducing your plastic footprint with its reusable design. A double walled, vacuum-insulated body is made of 18/8 stainless steel which insulates cold drinks for up to 24 hours and hot for up to 6 ho...


More Info
{"id":6617176145956,"title":"BUILT Water Bottle Ice Cube Tray, Red (k36a)","handle":"built-water-bottle-ice-cube-tray-red","description":"This tray makes long, thin ice cubes that fit easily into water bottles so you can add extra chill to your daily routine. Simply fill, freeze, and pop out from the flexible silicone base when you’re ready. It's made of non-toxic, LFGB-grade silicone. BUILT FOR BOTTLES: this ice tray makes narrow sticks that slot easily into water bottles. BUILT FOR MORE: the 2cm-wide sticks sit nicely in drinks glasses too. BUILT TO LAST: it’s made of odourless, BPA-free, LFGB-grade silicone, which won't spill while freezing. BUILT FOR EASY RELEASE: simply press the base to instantly pop sticks from the tray. USEFUL INFO: this dishwasher-safe tray makes seven sticks with NYC skyline designs. Twelve month guarantee","published_at":"2021-09-02T20:10:16+01:00","created_at":"2021-05-16T20:33:10+01:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":695,"price_min":695,"price_max":695,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39415717429284,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BLTICTRAY","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BUILT Water Bottle Ice Cube Tray, Red (k36a)","public_title":null,"options":["Default Title"],"price":695,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5057982069636","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BLTICTRAY_04icecubetray.jpg?v=1621193849","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BLTICTRAY_01icecubetray.jpg?v=1621193849"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BLTICTRAY_04icecubetray.jpg?v=1621193849","options":["Title"],"media":[{"alt":null,"id":20477785735204,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BLTICTRAY_04icecubetray.jpg?v=1621193849"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BLTICTRAY_04icecubetray.jpg?v=1621193849","width":500},{"alt":null,"id":20477785702436,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BLTICTRAY_01icecubetray.jpg?v=1621193849"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/BLTICTRAY_01icecubetray.jpg?v=1621193849","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"This tray makes long, thin ice cubes that fit easily into water bottles so you can add extra chill to your daily routine. Simply fill, freeze, and pop out from the flexible silicone base when you’re ready. It's made of non-toxic, LFGB-grade silicone. BUILT FOR BOTTLES: this ice tray makes narrow sticks that slot easily into water bottles. BUILT FOR MORE: the 2cm-wide sticks sit nicely in drinks glasses too. BUILT TO LAST: it’s made of odourless, BPA-free, LFGB-grade silicone, which won't spill while freezing. BUILT FOR EASY RELEASE: simply press the base to instantly pop sticks from the tray. USEFUL INFO: this dishwasher-safe tray makes seven sticks with NYC skyline designs. Twelve month guarantee"}
BUILT Water Bottle Ice Cube Tray, Red (k36a)

BUILT Water Bottle Ice Cube Tray, Red (k36a)

€6.95

This tray makes long, thin ice cubes that fit easily into water bottles so you can add extra chill to your daily routine. Simply fill, freeze, and pop out from the flexible silicone base when you’re ready. It's made of non-toxic, LFGB-grade silicone. BUILT FOR BOTTLES: this ice tray makes narrow sticks that slot easily into water bottles. BUILT ...


More Info
{"id":6541690208292,"title":"Bunny Egg Cup (317)","handle":"easter-bunny-egg-cup","description":"\u003cp\u003eThis bunny shaped egg cup is all it’s cracked up to be! Ideal for a boiled egg breakfast, lunch or dinner alongside all the trimmings. Pull it out at Easter or use an everyday essential. Size: 12cm x 5cm approx\u003c\/p\u003e","published_at":"2021-03-02T19:12:50+00:00","created_at":"2021-03-02T19:11:04+00:00","vendor":"Clayre en Eef","type":"","tags":["KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","TABLE \u0026 BAR"],"price":795,"price_min":795,"price_max":795,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39255878238244,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"6PR3317","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Bunny Egg Cup (317)","public_title":null,"options":["Default Title"],"price":795,"weight":0,"compare_at_price":null,"inventory_quantity":6,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6PR3317eggcup.jpg?v=1614712326"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6PR3317eggcup.jpg?v=1614712326","options":["Title"],"media":[{"alt":null,"id":20190231691300,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6PR3317eggcup.jpg?v=1614712326"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6PR3317eggcup.jpg?v=1614712326","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eThis bunny shaped egg cup is all it’s cracked up to be! Ideal for a boiled egg breakfast, lunch or dinner alongside all the trimmings. Pull it out at Easter or use an everyday essential. Size: 12cm x 5cm approx\u003c\/p\u003e"}
Bunny Egg Cup (317)

Bunny Egg Cup (317)

€7.95

This bunny shaped egg cup is all it’s cracked up to be! Ideal for a boiled egg breakfast, lunch or dinner alongside all the trimmings. Pull it out at Easter or use an everyday essential. Size: 12cm x 5cm approx


More Info
{"id":6541692272676,"title":"Bunny Egg Cup (318)","handle":"easter-bunny-egg-cup-green","description":"\u003cp\u003eThis bunny shaped egg cup is all it’s cracked up to be! Ideal for a boiled egg breakfast, lunch or dinner alongside all the trimmings. Pull it out at Easter or use an everyday essential. Size: 12cm x 5cm approx\u003c\/p\u003e","published_at":"2021-03-02T19:14:36+00:00","created_at":"2021-03-02T19:13:55+00:00","vendor":"Clayre en Eef","type":"","tags":["KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","TABLE \u0026 BAR"],"price":795,"price_min":795,"price_max":795,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39255880237092,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"6PR3318","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Bunny Egg Cup (318)","public_title":null,"options":["Default Title"],"price":795,"weight":0,"compare_at_price":null,"inventory_quantity":5,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6PR3318eggcupbunny.jpg?v=1614712452"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6PR3318eggcupbunny.jpg?v=1614712452","options":["Title"],"media":[{"alt":null,"id":20190240702500,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6PR3318eggcupbunny.jpg?v=1614712452"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6PR3318eggcupbunny.jpg?v=1614712452","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eThis bunny shaped egg cup is all it’s cracked up to be! Ideal for a boiled egg breakfast, lunch or dinner alongside all the trimmings. Pull it out at Easter or use an everyday essential. Size: 12cm x 5cm approx\u003c\/p\u003e"}
Bunny Egg Cup (318)

Bunny Egg Cup (318)

€7.95

This bunny shaped egg cup is all it’s cracked up to be! Ideal for a boiled egg breakfast, lunch or dinner alongside all the trimmings. Pull it out at Easter or use an everyday essential. Size: 12cm x 5cm approx


More Info
Sale
Cast Iron 2 Cup Japanese Style Infuser Teapot, 500ml (k95d)
{"id":5057957298212,"title":"Cast Iron 2 Cup Japanese Style Infuser Teapot, 500ml (k95d)","handle":"japanese-kettle-tetsubin-teapot-500-ml","description":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eKitchenCraft Le'Xpress 2 Cup Cast Iron Japanese-Style Teapot with Infuser, 500 ml (17.5 fl oz) in Black.  There are few beverages as important in Japanese food culture as tea: whether it's the matcha drank during tea ceremonies, or the black tea served in city side-street kissaten tea rooms. Steeped in the country's traditional tea culture, this Le'Xpress Japanese-style cast iron tetsubin kettle is perfect for making a superior brew you can enjoy in zen-like serenity. Unlike traditional Japanese teapots, it features a fine stainless steel mesh infuser - making it easy to steep your favourite loose leaf varieties to perfection. It doesn't matter whether you prefer an calming oolongcha, or a classic Earl Grey: just fill add your leaves to the infuser, pour in your boiling water and leave to steep. It can make up to 500 ml (or 2 cups) of tea, making it the ideal choice for early morning cuppas, or a brew when you've got a friend round. You'll never have to worry about rushing it either. This tetsubin kettle's cast iron construction and enamel-coated interior gives it strong heat retention. So, you can sit back and sip at your leisure! Capacity: 500 ml (17½ fl oz) Handwash only Not designed for stovetop use Always use an oven glove to handle when hot.\u003cbr\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\"\u003e\u003c\/div\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\"\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2021-02-16T23:58:57+00:00","created_at":"2021-02-14T13:37:57+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","tea","tea pot","teapot"],"price":2995,"price_min":2995,"price_max":2995,"available":true,"price_varies":false,"compare_at_price":3995,"compare_at_price_min":3995,"compare_at_price_max":3995,"compare_at_price_varies":false,"variants":[{"id":32627240108068,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCLXTEACAST04","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Cast Iron 2 Cup Japanese Style Infuser Teapot, 500ml (k95d)","public_title":null,"options":["Default Title"],"price":2995,"weight":0,"compare_at_price":3995,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250800374","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCLXTEACAST04castironteapot.jpg?v=1613346519","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCLXTEACAST04_20castironteapot.jpg?v=1613346519"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCLXTEACAST04castironteapot.jpg?v=1613346519","options":["Title"],"media":[{"alt":null,"id":8031260246052,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCLXTEACAST04castironteapot.jpg?v=1613346519"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCLXTEACAST04castironteapot.jpg?v=1613346519","width":500},{"alt":null,"id":8031260213284,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCLXTEACAST04_20castironteapot.jpg?v=1613346519"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/KCLXTEACAST04_20castironteapot.jpg?v=1613346519","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eKitchenCraft Le'Xpress 2 Cup Cast Iron Japanese-Style Teapot with Infuser, 500 ml (17.5 fl oz) in Black.  There are few beverages as important in Japanese food culture as tea: whether it's the matcha drank during tea ceremonies, or the black tea served in city side-street kissaten tea rooms. Steeped in the country's traditional tea culture, this Le'Xpress Japanese-style cast iron tetsubin kettle is perfect for making a superior brew you can enjoy in zen-like serenity. Unlike traditional Japanese teapots, it features a fine stainless steel mesh infuser - making it easy to steep your favourite loose leaf varieties to perfection. It doesn't matter whether you prefer an calming oolongcha, or a classic Earl Grey: just fill add your leaves to the infuser, pour in your boiling water and leave to steep. It can make up to 500 ml (or 2 cups) of tea, making it the ideal choice for early morning cuppas, or a brew when you've got a friend round. You'll never have to worry about rushing it either. This tetsubin kettle's cast iron construction and enamel-coated interior gives it strong heat retention. So, you can sit back and sip at your leisure! Capacity: 500 ml (17½ fl oz) Handwash only Not designed for stovetop use Always use an oven glove to handle when hot.\u003cbr\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\"\u003e\u003c\/div\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\"\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
Cast Iron 2 Cup Japanese Style Infuser Teapot, 500ml (k95d)

Cast Iron 2 Cup Japanese Style Infuser Teapot, 500ml (k95d)

€29.95

KitchenCraft Le'Xpress 2 Cup Cast Iron Japanese-Style Teapot with Infuser, 500 ml (17.5 fl oz) in Black.  There are few beverages as important in Japanese food culture as tea: whether it's the matcha drank during tea ceremonies, or the black tea served in city side-street kissaten tea rooms. Steeped in the country's traditional tea culture, t...


More Info
{"id":383745720356,"title":"Ceramic Cake Stand With Glass Dome Lid, 29cm (k98a)","handle":"classic-collection-ceramic-cake-stand-with-glass-dome","description":"This Cake Stand is perfect for elegantly presenting and serving your favourite cakes, desserts, biscuits and pies. The beautifully shaped stoneware stand, with centre motif, comes complete with a glass domed lid. This lid not only acts as a cover, but also leaves the cakes clearly visible for temptation. Size: 29cm x 25cm. Dishwasher safe - However, due to the delicate nature of glass, it is recommended that the lid be handwashed. Gift boxed.","published_at":"2021-05-11T11:39:48+01:00","created_at":"2017-11-21T16:37:03+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT"],"price":6895,"price_min":6895,"price_max":6895,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4975237136420,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"TPCCSTAND","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Ceramic Cake Stand With Glass Dome Lid, 29cm (k98a)","public_title":null,"options":["Default Title"],"price":6895,"weight":0,"compare_at_price":null,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250158598","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cakestand.jpg?v=1633380485","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cakestandwithdomelid..jpg?v=1633380705","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cakestandwithdomelid_1.jpg?v=1633380770"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cakestand.jpg?v=1633380485","options":["Title"],"media":[{"alt":null,"id":20958807719972,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cakestand.jpg?v=1633380485"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cakestand.jpg?v=1633380485","width":600},{"alt":null,"id":20958809554980,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cakestandwithdomelid..jpg?v=1633380705"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cakestandwithdomelid..jpg?v=1633380705","width":600},{"alt":null,"id":20958812504100,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cakestandwithdomelid_1.jpg?v=1633380770"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cakestandwithdomelid_1.jpg?v=1633380770","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"This Cake Stand is perfect for elegantly presenting and serving your favourite cakes, desserts, biscuits and pies. The beautifully shaped stoneware stand, with centre motif, comes complete with a glass domed lid. This lid not only acts as a cover, but also leaves the cakes clearly visible for temptation. Size: 29cm x 25cm. Dishwasher safe - However, due to the delicate nature of glass, it is recommended that the lid be handwashed. Gift boxed."}
Ceramic Cake Stand With Glass Dome Lid, 29cm (k98a)

Ceramic Cake Stand With Glass Dome Lid, 29cm (k98a)

€68.95

This Cake Stand is perfect for elegantly presenting and serving your favourite cakes, desserts, biscuits and pies. The beautifully shaped stoneware stand, with centre motif, comes complete with a glass domed lid. This lid not only acts as a cover, but also leaves the cakes clearly visible for temptation. Size: 29cm x 25cm. Dishwasher safe - Howe...


More Info
{"id":6540432080932,"title":"Ceramic Honey Jar With Spoon, Yellow","handle":"ceramic-honey-jar-with-spoon-yellow","description":"\u003cp\u003eYellow Country Style honey pot with a spoon and bees detail. Size: 11cm x 14cm approx.\u003cbr\u003e\u003c\/p\u003e","published_at":"2021-03-01T22:53:09+00:00","created_at":"2021-03-01T22:49:52+00:00","vendor":"Clayre en Eef","type":"","tags":["KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW"],"price":1395,"price_min":1395,"price_max":1395,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39253405696036,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"6CE1147","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Ceramic Honey Jar With Spoon, Yellow","public_title":null,"options":["Default Title"],"price":1395,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"8717459738386","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6CE1147honeypot.jpg?v=1614639177","\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6CE1147_1honeypot.jpg?v=1614639177"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6CE1147honeypot.jpg?v=1614639177","options":["Title"],"media":[{"alt":null,"id":20185400311844,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6CE1147honeypot.jpg?v=1614639177"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6CE1147honeypot.jpg?v=1614639177","width":500},{"alt":null,"id":20185400344612,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6CE1147_1honeypot.jpg?v=1614639177"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/6CE1147_1honeypot.jpg?v=1614639177","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eYellow Country Style honey pot with a spoon and bees detail. Size: 11cm x 14cm approx.\u003cbr\u003e\u003c\/p\u003e"}
Ceramic Honey Jar With Spoon, Yellow

Ceramic Honey Jar With Spoon, Yellow

€13.95

Yellow Country Style honey pot with a spoon and bees detail. Size: 11cm x 14cm approx.


More Info
{"id":5004958269476,"title":"CHEF AID COCKTAIL STICKS, PACK OF 200 (g01z)","handle":"chef-aid-cocktail-sticks-pack-of-200","description":"The Chef Aid Cocktail Sticks are ideal for serving olives cherries sandwiches and canapés for guests. Our cocktail sticks are perfect for parties and picnics. They come in a pack of 200.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e","published_at":"2021-06-22T20:41:41+01:00","created_at":"2020-12-10T22:01:32+00:00","vendor":"George East","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":150,"price_min":150,"price_max":150,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32510701731876,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"10E61120","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"CHEF AID COCKTAIL STICKS, PACK OF 200 (g01z)","public_title":null,"options":["Default Title"],"price":150,"weight":0,"compare_at_price":null,"inventory_quantity":9,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5012904611201","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/10E61120cocktailstick_2.jpg?v=1636753797"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/10E61120cocktailstick_2.jpg?v=1636753797","options":["Title"],"media":[{"alt":null,"id":21173733752868,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/10E61120cocktailstick_2.jpg?v=1636753797"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/10E61120cocktailstick_2.jpg?v=1636753797","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"The Chef Aid Cocktail Sticks are ideal for serving olives cherries sandwiches and canapés for guests. Our cocktail sticks are perfect for parties and picnics. They come in a pack of 200.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e"}
CHEF AID COCKTAIL STICKS, PACK OF 200 (g01z)

CHEF AID COCKTAIL STICKS, PACK OF 200 (g01z)

€1.50

The Chef Aid Cocktail Sticks are ideal for serving olives cherries sandwiches and canapés for guests. Our cocktail sticks are perfect for parties and picnics. They come in a pack of 200.


More Info
{"id":5004889751588,"title":"CHEF AID NUTCRACKER (g58z)","handle":"chef-aid-nutcracker","description":"The Chef Aid Nutcracker is an essential piece of equipment. The utensil allows you to quickly and effortlessly crack any size of nut. The cracker also works on shellfish. Our nutcracker is made of high quality durable stainless steel.\u003cbr\u003e\u003cbr\u003e","published_at":"2020-12-10T18:20:40+00:00","created_at":"2020-12-10T18:19:05+00:00","vendor":"George East","type":"","tags":["KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","TABLE \u0026 BAR"],"price":595,"price_min":595,"price_max":595,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32510350786596,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"10E03475","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"CHEF AID NUTCRACKER (g58z)","public_title":null,"options":["Default Title"],"price":595,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5012904034758","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/NUTCRACKER.jpg?v=1607624399"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/NUTCRACKER.jpg?v=1607624399","options":["Title"],"media":[{"alt":null,"id":7757174439972,"position":1,"preview_image":{"aspect_ratio":1.0,"height":480,"width":480,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/NUTCRACKER.jpg?v=1607624399"},"aspect_ratio":1.0,"height":480,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/NUTCRACKER.jpg?v=1607624399","width":480}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"The Chef Aid Nutcracker is an essential piece of equipment. The utensil allows you to quickly and effortlessly crack any size of nut. The cracker also works on shellfish. Our nutcracker is made of high quality durable stainless steel.\u003cbr\u003e\u003cbr\u003e"}
CHEF AID NUTCRACKER (g58z)

CHEF AID NUTCRACKER (g58z)

€5.95

The Chef Aid Nutcracker is an essential piece of equipment. The utensil allows you to quickly and effortlessly crack any size of nut. The cracker also works on shellfish. Our nutcracker is made of high quality durable stainless steel.


More Info
{"id":5004889325604,"title":"CHEF AID OIL POURERS, SET OF 2 (g01z)","handle":"chef-aid-oil-pourers-set-of-2","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eBeautifully designed, this 2 in 1 oil and vinegar cruet bottle gracefully adorns any work surface or dining table and adds a real world of flavour to your Italian themed dining experience. Ideal for storing and serving both oil and vinegar for salads, bread and antipasti, the bottle features two individual pouring spouts with cork stoppers. Dishwasher safe (with cork removed). 12 month guarantee\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2020-12-10T18:17:55+00:00","created_at":"2020-12-10T18:16:33+00:00","vendor":"George East","type":"","tags":["Creative Cook","KITCHENCRAFT","TABLE \u0026 BAR"],"price":225,"price_min":225,"price_max":225,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32510349606948,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"10E00800","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"CHEF AID OIL POURERS, SET OF 2 (g01z)","public_title":null,"options":["Default Title"],"price":225,"weight":0,"compare_at_price":null,"inventory_quantity":8,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5012904008001","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/OILPOURERS.jpg?v=1607624248"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/OILPOURERS.jpg?v=1607624248","options":["Title"],"media":[{"alt":null,"id":7757165101092,"position":1,"preview_image":{"aspect_ratio":1.0,"height":480,"width":480,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/OILPOURERS.jpg?v=1607624248"},"aspect_ratio":1.0,"height":480,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/OILPOURERS.jpg?v=1607624248","width":480}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eBeautifully designed, this 2 in 1 oil and vinegar cruet bottle gracefully adorns any work surface or dining table and adds a real world of flavour to your Italian themed dining experience. Ideal for storing and serving both oil and vinegar for salads, bread and antipasti, the bottle features two individual pouring spouts with cork stoppers. Dishwasher safe (with cork removed). 12 month guarantee\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
CHEF AID OIL POURERS, SET OF 2 (g01z)

CHEF AID OIL POURERS, SET OF 2 (g01z)

€2.25

Beautifully designed, this 2 in 1 oil and vinegar cruet bottle gracefully adorns any work surface or dining table and adds a real world of flavour to your Italian themed dining experience. Ideal for storing and serving both oil and vinegar for salads, bread and antipasti, the bottle features two individual pouring spouts with cork stoppers. Di...


More Info
{"id":6754839822372,"title":"Chef Wine Bottle Holder","handle":"wine-bottle-holder-chef","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eSilver-coloured metal bottle holder in the shape of a chef. \u003cmeta charset=\"utf-8\"\u003e \u003cspan data-mce-fragment=\"1\"\u003ePerfect as a gift for the wine lover or for an aspiring chef. \u003c\/span\u003e Size: 15*14*22 cm. \u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2021-09-29T23:26:12+01:00","created_at":"2021-09-29T23:21:49+01:00","vendor":"Clayre en Eef","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":2395,"price_min":2395,"price_max":2395,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39605283061796,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"6y3788","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Chef Wine Bottle Holder","public_title":null,"options":["Default Title"],"price":2395,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cookchefwinebottleholder2_8ae15f3e-48df-4449-8436-eb5b0a714ded.jpg?v=1632954322"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cookchefwinebottleholder2_8ae15f3e-48df-4449-8436-eb5b0a714ded.jpg?v=1632954322","options":["Title"],"media":[{"alt":null,"id":20940864684068,"position":1,"preview_image":{"aspect_ratio":1.0,"height":470,"width":470,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cookchefwinebottleholder2_8ae15f3e-48df-4449-8436-eb5b0a714ded.jpg?v=1632954322"},"aspect_ratio":1.0,"height":470,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/cookchefwinebottleholder2_8ae15f3e-48df-4449-8436-eb5b0a714ded.jpg?v=1632954322","width":470}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eSilver-coloured metal bottle holder in the shape of a chef. \u003cmeta charset=\"utf-8\"\u003e \u003cspan data-mce-fragment=\"1\"\u003ePerfect as a gift for the wine lover or for an aspiring chef. \u003c\/span\u003e Size: 15*14*22 cm. \u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
Chef Wine Bottle Holder

Chef Wine Bottle Holder

€23.95

Silver-coloured metal bottle holder in the shape of a chef. Perfect as a gift for the wine lover or for an aspiring chef.  Size: 15*14*22 cm. 


More Info
Sale
Chrome Steel Fondue Burner (D201)
{"id":385125646372,"title":"Chrome Steel Fondue Burner (D201)","handle":"chasseur-fondue-burner","description":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003eA spare part for your fondue burner. Universal model for all types of brackets.\u003cbr data-mce-fragment=\"1\"\u003eUse with alcohol and fuel gel. Chrome steel finish for durability and quality. Quick and easy to light. A perfect replacement for your existing fondue burner. Approx Size: Length incl handle: 15cm, Width: 9.5cm, Height\/Depth: 5cm.\u003c\/p\u003e","published_at":"2020-11-13T16:42:35+00:00","created_at":"2017-11-22T15:15:50+00:00","vendor":"Dexam","type":"","tags":["KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","TABLE \u0026 BAR"],"price":1695,"price_min":1695,"price_max":1695,"available":true,"price_varies":false,"compare_at_price":2495,"compare_at_price_min":2495,"compare_at_price_max":2495,"compare_at_price_varies":false,"variants":[{"id":4985513213988,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"1185201","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Chrome Steel Fondue Burner (D201)","public_title":null,"options":["Default Title"],"price":1695,"weight":0,"compare_at_price":2495,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"3244331077004","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/1185201_20fondue_20burner.jpg?v=1511363750"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/1185201_20fondue_20burner.jpg?v=1511363750","options":["Title"],"media":[{"alt":null,"id":727062937636,"position":1,"preview_image":{"aspect_ratio":1.0,"height":440,"width":440,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/1185201_20fondue_20burner.jpg?v=1511363750"},"aspect_ratio":1.0,"height":440,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/2524\/3748\/products\/1185201_20fondue_20burner.jpg?v=1511363750","width":440}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cmeta charset=\"utf-8\"\u003e\n\u003cp\u003eA spare part for your fondue burner. Universal model for all types of brackets.\u003cbr data-mce-fragment=\"1\"\u003eUse with alcohol and fuel gel. Chrome steel finish for durability and quality. Quick and easy to light. A perfect replacement for your existing fondue burner. Approx Size: Length incl handle: 15cm, Width: 9.5cm, Height\/Depth: 5cm.\u003c\/p\u003e"}
Chrome Steel Fondue Burner (D201)

Chrome Steel Fondue Burner (D201)

€16.95

A spare part for your fondue burner. Universal model for all types of brackets.Use with alcohol and fuel gel. Chrome steel finish for durability and quality. Quick and easy to light. A perfect replacement for your existing fondue burner. Approx Size: Length incl handle: 15cm, Width: 9.5cm, Height/Depth: 5cm.


More Info