ONE4ALL, PAYPAL & ALL MAJOR CREDIT CARDS ACCEPTED. FREE DELIVERY OVER €75.

TABLE & BAR

Sort by:
{"id":4794136297508,"title":"4 Tier Fold Up Card Cupcake Stand (K853)","handle":"4-tier-fold-up-card-cake-stand","description":"Perfect for weddings and other celebrations, this four tier card cake stand holds and presents cupcakes and a variety of other delicious and tasty treats! Easy to assemble, this stand holds up to 36 cupcakes. Disposable items. Size: 48.5cm x 42cm. Holds up to 36 cupcakes","published_at":"2020-11-28T01:39:40+00:00","created_at":"2020-07-27T14:08:31+01:00","vendor":"Kitchencraft","type":"","tags":["BAKEWARE \u0026 SUGARCRAFT","KITCHENCRAFT","TABLE \u0026 BAR"],"price":495,"price_min":495,"price_max":495,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":32243236962340,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"SDI4TCSTAND","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"4 Tier Fold Up Card Cupcake Stand (K853)","public_title":null,"options":["Default Title"],"price":495,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250495853","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/SDI4TCSTANDFOLDUPCAKESTAND.jpg?v=1595855527"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/SDI4TCSTANDFOLDUPCAKESTAND.jpg?v=1595855527","options":["Title"],"media":[{"alt":null,"id":7169977188388,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/SDI4TCSTANDFOLDUPCAKESTAND.jpg?v=1595855527"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/SDI4TCSTANDFOLDUPCAKESTAND.jpg?v=1595855527","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Perfect for weddings and other celebrations, this four tier card cake stand holds and presents cupcakes and a variety of other delicious and tasty treats! Easy to assemble, this stand holds up to 36 cupcakes. Disposable items. Size: 48.5cm x 42cm. Holds up to 36 cupcakes"}
4 Tier Fold Up Card Cupcake Stand (K853)

4 Tier Fold Up Card Cupcake Stand (K853)

€4.95

Perfect for weddings and other celebrations, this four tier card cake stand holds and presents cupcakes and a variety of other delicious and tasty treats! Easy to assemble, this stand holds up to 36 cupcakes. Disposable items. Size: 48.5cm x 42cm. Holds up to 36 cupcakes


More Info
{"id":6835543539748,"title":"Acrylic Champagne \u0026 Wine Cooler Pail (ed02)","handle":"acrylic-champagne-bucket-wine-cooler","description":"\u003cp\u003eA useful acrylic drinks pail to chill wine, water and champagne bottles. With a stylish angled shape with integrated handles, the pail is ideal for dinner parties and small get togethers. Size:  23 x 23 x 18cm\u003c\/p\u003e","published_at":"2021-11-26T23:14:14+00:00","created_at":"2021-11-26T22:51:06+00:00","vendor":"Eddingtons","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":1695,"price_min":1695,"price_max":1695,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39755237687332,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"39F1257","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Acrylic Champagne \u0026 Wine Cooler Pail (ed02)","public_title":null,"options":["Default Title"],"price":1695,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"4710900632602","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/acrylicchampagneandwinedrinkspail_1.jpg?v=1638283851"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/acrylicchampagneandwinedrinkspail_1.jpg?v=1638283851","options":["Title"],"media":[{"alt":null,"id":21287626211364,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/products\/acrylicchampagneandwinedrinkspail_1.jpg?v=1638283851"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/acrylicchampagneandwinedrinkspail_1.jpg?v=1638283851","width":700}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eA useful acrylic drinks pail to chill wine, water and champagne bottles. With a stylish angled shape with integrated handles, the pail is ideal for dinner parties and small get togethers. Size:  23 x 23 x 18cm\u003c\/p\u003e"}
Acrylic Champagne & Wine Cooler Pail (ed02)

Acrylic Champagne & Wine Cooler Pail (ed02)

€16.95

A useful acrylic drinks pail to chill wine, water and champagne bottles. With a stylish angled shape with integrated handles, the pail is ideal for dinner parties and small get togethers. Size:  23 x 23 x 18cm


More Info
{"id":383775178788,"title":"Acrylic Double Walled Wine Cooler (k309)","handle":"acrylic-double-walled-wine-cooler","description":"Bar Craft clear acrylic wine cooler with a contrasting polished silver rim and base. Stylish for use directly at the table to keep chilled wine cooler for longer. Handwash only. Display boxed.","published_at":"2020-11-28T12:09:49+00:00","created_at":"2017-11-21T17:04:50+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":1595,"price_min":1595,"price_max":1595,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4975460810788,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCWCOOL","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Acrylic Double Walled Wine Cooler (k309)","public_title":null,"options":["Default Title"],"price":1595,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250125309","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/doublewalledwinecooler.jpg?v=1712952819","\/\/anvil.ie\/cdn\/shop\/products\/doublewalledwinecooler..jpg?v=1636750996"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/doublewalledwinecooler.jpg?v=1712952819","options":["Title"],"media":[{"alt":null,"id":21173333131300,"position":1,"preview_image":{"aspect_ratio":1.0,"height":563,"width":563,"src":"\/\/anvil.ie\/cdn\/shop\/products\/doublewalledwinecooler.jpg?v=1712952819"},"aspect_ratio":1.0,"height":563,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/doublewalledwinecooler.jpg?v=1712952819","width":563},{"alt":null,"id":21173333098532,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/doublewalledwinecooler..jpg?v=1636750996"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/doublewalledwinecooler..jpg?v=1636750996","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Bar Craft clear acrylic wine cooler with a contrasting polished silver rim and base. Stylish for use directly at the table to keep chilled wine cooler for longer. Handwash only. Display boxed."}
Acrylic Double Walled Wine Cooler (k309)

Acrylic Double Walled Wine Cooler (k309)

€15.95

Bar Craft clear acrylic wine cooler with a contrasting polished silver rim and base. Stylish for use directly at the table to keep chilled wine cooler for longer. Handwash only. Display boxed.


More Info
{"id":6845372563492,"title":"Artesà Appetiser Acacia Wood Serving \u0026 Baguette Board, 48cm","handle":"artesa-appetiser-acacia-wood-serving-baguette-board","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eIncreasingly the way to serve cold meats, pickles, antipasti and of course a selection of bread, this natural acacia wood board features heavy grain and a decorative motif for added style. We recommend hand washing. Size: 48cm x 13cm (19\" x 5\")\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-12-13T21:42:55+00:00","created_at":"2021-12-01T21:27:45+00:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":1795,"price_min":1795,"price_max":1795,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39773818454052,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTBBOARD","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Appetiser Acacia Wood Serving \u0026 Baguette Board, 48cm","public_title":null,"options":["Default Title"],"price":1795,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250472564","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/woodenservingplankboard.jpg?v=1638394340","\/\/anvil.ie\/cdn\/shop\/products\/woodenservingplankboard_069e627e-ba81-4d35-9bd7-19de09be52f6.jpg?v=1638394340"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/woodenservingplankboard.jpg?v=1638394340","options":["Title"],"media":[{"alt":null,"id":21295259156516,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/products\/woodenservingplankboard.jpg?v=1638394340"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/woodenservingplankboard.jpg?v=1638394340","width":700},{"alt":null,"id":21295255715876,"position":2,"preview_image":{"aspect_ratio":1.0,"height":690,"width":690,"src":"\/\/anvil.ie\/cdn\/shop\/products\/woodenservingplankboard_069e627e-ba81-4d35-9bd7-19de09be52f6.jpg?v=1638394340"},"aspect_ratio":1.0,"height":690,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/woodenservingplankboard_069e627e-ba81-4d35-9bd7-19de09be52f6.jpg?v=1638394340","width":690}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eIncreasingly the way to serve cold meats, pickles, antipasti and of course a selection of bread, this natural acacia wood board features heavy grain and a decorative motif for added style. We recommend hand washing. Size: 48cm x 13cm (19\" x 5\")\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Appetiser Acacia Wood Serving & Baguette Board, 48cm

Artesà Appetiser Acacia Wood Serving & Baguette Board, 48cm

€17.95

Increasingly the way to serve cold meats, pickles, antipasti and of course a selection of bread, this natural acacia wood board features heavy grain and a decorative motif for added style. We recommend hand washing. Size: 48cm x 13cm (19" x 5")


More Info
Sale
Artesà Copper Mini Saucepan, 8.5.cm (k222)
{"id":4990306058276,"title":"Artesà Copper Mini Saucepan, 8.5.cm (k222)","handle":"artesa-copper-tri-ply-mini-saucepan-8-5-cm","description":"\u003cp\u003eBeautifully quaint, effortlessly elegant. This stainless steel and copper tri-ply mini saucepan is ideal for cooking sauces and serving starters, appetisers and accompaniments. With a triply base for durability and even heat distribution, this mini saucepan is perfect for enjoying fine dining in true artisan style with friends and family. Handwash only. 5 year guarantee. Size: 8.5cm\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/p\u003e","published_at":"2020-11-22T21:33:42+00:00","created_at":"2020-11-22T18:46:45+00:00","vendor":"EA Symmons","type":"","tags":["COOKWARE","KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","SAUCEPAN","STOCK POT","STOCKPOT","TABLE \u0026 BAR"],"price":1695,"price_min":1695,"price_max":1695,"available":true,"price_varies":false,"compare_at_price":2695,"compare_at_price_min":2695,"compare_at_price_max":2695,"compare_at_price_varies":false,"variants":[{"id":32482211233828,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTMSAUC8","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Copper Mini Saucepan, 8.5.cm (k222)","public_title":null,"options":["Default Title"],"price":1695,"weight":0,"compare_at_price":2695,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250666222","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/ARTMSAUC8minicoppersaucepan_1.jpg?v=1636842541","\/\/anvil.ie\/cdn\/shop\/products\/ARTMSAUC8minicoppersaucepan2.jpg?v=1606080264"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/ARTMSAUC8minicoppersaucepan_1.jpg?v=1636842541","options":["Title"],"media":[{"alt":null,"id":21184642482212,"position":1,"preview_image":{"aspect_ratio":1.0,"height":423,"width":423,"src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTMSAUC8minicoppersaucepan_1.jpg?v=1636842541"},"aspect_ratio":1.0,"height":423,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTMSAUC8minicoppersaucepan_1.jpg?v=1636842541","width":423},{"alt":null,"id":7676026847268,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTMSAUC8minicoppersaucepan2.jpg?v=1606080264"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTMSAUC8minicoppersaucepan2.jpg?v=1606080264","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eBeautifully quaint, effortlessly elegant. This stainless steel and copper tri-ply mini saucepan is ideal for cooking sauces and serving starters, appetisers and accompaniments. With a triply base for durability and even heat distribution, this mini saucepan is perfect for enjoying fine dining in true artisan style with friends and family. Handwash only. 5 year guarantee. Size: 8.5cm\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/p\u003e"}
Artesà Copper Mini Saucepan, 8.5.cm (k222)

Artesà Copper Mini Saucepan, 8.5.cm (k222)

€16.95

Beautifully quaint, effortlessly elegant. This stainless steel and copper tri-ply mini saucepan is ideal for cooking sauces and serving starters, appetisers and accompaniments. With a triply base for durability and even heat distribution, this mini saucepan is perfect for enjoying fine dining in true artisan style with friends and family. Handwa...


More Info
Sale
Artesà Copper Mini Serving Pot With Handles, 12cm (k952)
{"id":4990478975012,"title":"Artesà Copper Mini Serving Pot With Handles, 12cm (k952)","handle":"artesa-hammered-copper-mini-saucepan-serving-pot-12cm","description":"\u003cp\u003eCreate an instant, quirky gastro pub feel at your next dinner party, by serving up delicious dishes using this hammered copper serving pot. Copper has a warm, vibrant glow that’s sure to light up the room whenever this dish is around It’s reflective, hammered finish lends an quirky, industrial feel and restaurant would envy, complete with contrasting gold coloured handles bolted on to the sides. Practical too, the handles make it easy to move the pan around, so your guests can pass the dish along the table with ease. At 12 cm (4½\") in diameter, this serving dish is the ideal size for individual portions or for sharing rice, vegetables or curries. Give each diner their own hammered copper dish when you’re serving starters or use it to present sides or tapas selections that everyone can share. Copper finish. Food safe. Handwash only. Please note: this saucepan is for serving only and not suitable for stovetop use\u003cbr\u003e\u003c\/p\u003e","published_at":"2020-11-22T21:47:15+00:00","created_at":"2020-11-22T21:40:35+00:00","vendor":"EA Symmons","type":"","tags":["COOKWARE","KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","SAUCEPAN","STOCK POT","STOCKPOT","TABLE \u0026 BAR"],"price":1495,"price_min":1495,"price_max":1495,"available":true,"price_varies":false,"compare_at_price":1995,"compare_at_price_min":1995,"compare_at_price_max":1995,"compare_at_price_varies":false,"variants":[{"id":32482344927268,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"artminipot12","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Copper Mini Serving Pot With Handles, 12cm (k952)","public_title":null,"options":["Default Title"],"price":1495,"weight":0,"compare_at_price":1995,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250776952","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/artminipot8minicoppersaucepan_1.jpg?v=1636842356"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/artminipot8minicoppersaucepan_1.jpg?v=1636842356","options":["Title"],"media":[{"alt":null,"id":21184630751268,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/artminipot8minicoppersaucepan_1.jpg?v=1636842356"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/artminipot8minicoppersaucepan_1.jpg?v=1636842356","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eCreate an instant, quirky gastro pub feel at your next dinner party, by serving up delicious dishes using this hammered copper serving pot. Copper has a warm, vibrant glow that’s sure to light up the room whenever this dish is around It’s reflective, hammered finish lends an quirky, industrial feel and restaurant would envy, complete with contrasting gold coloured handles bolted on to the sides. Practical too, the handles make it easy to move the pan around, so your guests can pass the dish along the table with ease. At 12 cm (4½\") in diameter, this serving dish is the ideal size for individual portions or for sharing rice, vegetables or curries. Give each diner their own hammered copper dish when you’re serving starters or use it to present sides or tapas selections that everyone can share. Copper finish. Food safe. Handwash only. Please note: this saucepan is for serving only and not suitable for stovetop use\u003cbr\u003e\u003c\/p\u003e"}
Artesà Copper Mini Serving Pot With Handles, 12cm (k952)

Artesà Copper Mini Serving Pot With Handles, 12cm (k952)

€14.95

Create an instant, quirky gastro pub feel at your next dinner party, by serving up delicious dishes using this hammered copper serving pot. Copper has a warm, vibrant glow that’s sure to light up the room whenever this dish is around It’s reflective, hammered finish lends an quirky, industrial feel and restaurant would envy, complete with contra...


More Info
Sale
Artesà Copper Mini Serving Pot With Handles, 8cm (k869)
{"id":4990486675492,"title":"Artesà Copper Mini Serving Pot With Handles, 8cm (k869)","handle":"artesa-copper-mini-serving-pot-with-handles-i8cm","description":"\u003cp\u003eCreate an instant, quirky gastro pub feel at your next dinner party, by serving up delicious dishes using this hammered copper serving pot. Copper has a warm, vibrant glow that’s sure to light up the room whenever this dish is around It’s reflective, hammered finish lends an quirky, industrial feel and restaurant would envy, complete with contrasting gold coloured handles bolted on to the sides. Practical too, the handles make it easy to move the pan around, so your guests can pass the dish along the table with ease. This 8 cm (3 inch) round dish has high sides, so you can use it to serve up all manner of different nibbles and sides, from nuts and rice, to chips and dips. Give each diner their own hammered copper dish when you’re serving starters or use it to present sides or tapas selections that everyone can share. Copper finish. Food safe. Handwash only. Please note: this saucepan is for serving only and not suitable for stovetop use\u003cbr\u003e\u003c\/p\u003e","published_at":"2020-11-22T21:56:55+00:00","created_at":"2020-11-22T21:55:04+00:00","vendor":"EA Symmons","type":"","tags":["COOKWARE","KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","SAUCEPAN","STOCK POT","STOCKPOT","TABLE \u0026 BAR"],"price":895,"price_min":895,"price_max":895,"available":true,"price_varies":false,"compare_at_price":1495,"compare_at_price_min":1495,"compare_at_price_max":1495,"compare_at_price_varies":false,"variants":[{"id":32482351480868,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTMINIPOT8","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Copper Mini Serving Pot With Handles, 8cm (k869)","public_title":null,"options":["Default Title"],"price":895,"weight":0,"compare_at_price":1495,"inventory_quantity":6,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250760869","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/ARTMINIPOT8_01copperminiservingpot_1.jpg?v=1636842418"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/ARTMINIPOT8_01copperminiservingpot_1.jpg?v=1636842418","options":["Title"],"media":[{"alt":null,"id":21184636780580,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTMINIPOT8_01copperminiservingpot_1.jpg?v=1636842418"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTMINIPOT8_01copperminiservingpot_1.jpg?v=1636842418","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eCreate an instant, quirky gastro pub feel at your next dinner party, by serving up delicious dishes using this hammered copper serving pot. Copper has a warm, vibrant glow that’s sure to light up the room whenever this dish is around It’s reflective, hammered finish lends an quirky, industrial feel and restaurant would envy, complete with contrasting gold coloured handles bolted on to the sides. Practical too, the handles make it easy to move the pan around, so your guests can pass the dish along the table with ease. This 8 cm (3 inch) round dish has high sides, so you can use it to serve up all manner of different nibbles and sides, from nuts and rice, to chips and dips. Give each diner their own hammered copper dish when you’re serving starters or use it to present sides or tapas selections that everyone can share. Copper finish. Food safe. Handwash only. Please note: this saucepan is for serving only and not suitable for stovetop use\u003cbr\u003e\u003c\/p\u003e"}
Artesà Copper Mini Serving Pot With Handles, 8cm (k869)

Artesà Copper Mini Serving Pot With Handles, 8cm (k869)

€8.95

Create an instant, quirky gastro pub feel at your next dinner party, by serving up delicious dishes using this hammered copper serving pot. Copper has a warm, vibrant glow that’s sure to light up the room whenever this dish is around It’s reflective, hammered finish lends an quirky, industrial feel and restaurant would envy, complete with contra...


More Info
{"id":6617178996772,"title":"Artesà Gourmet Cheese Brie Baker (k277)","handle":"artesa-gourmet-cheese-brie-baker","description":"Cheese and wine has never been more popular and this cheese baker is ideal for adding a touch of luxury to serving. Perfect for indulging in a deliciously melted cheese starter or adding a warm twist to traditional cheese boards, this cheese baker is suitable for baking in the oven and also a sophisticated way to serve Camembert at the dining table. This ceramic baking dish is a beautiful quality piece for entertaining at home with a vintage red cheese label design. Dimensions: 4.75 x 2\/120mm (diameter) x 55mm.","published_at":"2024-04-11T14:11:30+01:00","created_at":"2021-05-16T20:42:29+01:00","vendor":"Kitchencraft","type":"","tags":["COOKWARE","KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","TABLE \u0026 BAR","The Hostess"],"price":2450,"price_min":2450,"price_max":2450,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39415724245028,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"5122277","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Gourmet Cheese Brie Baker (k277)","public_title":null,"options":["Default Title"],"price":2450,"weight":0,"compare_at_price":null,"inventory_quantity":4,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5050993157156","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/5122277_20briebaker.jpg?v=1632328971","\/\/anvil.ie\/cdn\/shop\/products\/5122277briebaker_1.jpg?v=1632328846"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/5122277_20briebaker.jpg?v=1632328971","options":["Title"],"media":[{"alt":null,"id":20477807689764,"position":1,"preview_image":{"aspect_ratio":1.257,"height":389,"width":489,"src":"\/\/anvil.ie\/cdn\/shop\/products\/5122277_20briebaker.jpg?v=1632328971"},"aspect_ratio":1.257,"height":389,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/5122277_20briebaker.jpg?v=1632328971","width":489},{"alt":null,"id":20916666826788,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/5122277briebaker_1.jpg?v=1632328846"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/5122277briebaker_1.jpg?v=1632328846","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Cheese and wine has never been more popular and this cheese baker is ideal for adding a touch of luxury to serving. Perfect for indulging in a deliciously melted cheese starter or adding a warm twist to traditional cheese boards, this cheese baker is suitable for baking in the oven and also a sophisticated way to serve Camembert at the dining table. This ceramic baking dish is a beautiful quality piece for entertaining at home with a vintage red cheese label design. Dimensions: 4.75 x 2\/120mm (diameter) x 55mm."}
Artesà Gourmet Cheese Brie Baker (k277)

Artesà Gourmet Cheese Brie Baker (k277)

€24.50

Cheese and wine has never been more popular and this cheese baker is ideal for adding a touch of luxury to serving. Perfect for indulging in a deliciously melted cheese starter or adding a warm twist to traditional cheese boards, this cheese baker is suitable for baking in the oven and also a sophisticated way to serve Camembert at the dining ta...


More Info
{"id":386620129316,"title":"Artesà Raclette Pan with Burner Stand (k989)","handle":"artesa-raclette-pan-with-burner-stand","description":"Perfect for a dinner party! This individual 9.5cm raclette with stand comes complete with burner, stand and wooden spatula, ideal for heating a variety of cheeses to spread over potatoes, gherkins and meat. A great dining accessory when enjoying an evening of fine artisan style dining and perfect for a romantic evening enjoying quality, homemade comforts. Raclette is handwash only. Wipe clean only the stand and burner once cool. Set includes: 1 x metal rack, 2 x tealights, 1 x wooden spatula \u0026amp; 1 x non-stick pan. Size: 8cm x 9.5cm x 19cm. Gift boxed","published_at":"2023-06-07T09:30:24+01:00","created_at":"2017-11-23T14:43:32+00:00","vendor":"Kitchencraft","type":"","tags":["COOKWARE","KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","TABLE \u0026 BAR","The Hostess"],"price":1675,"price_min":1675,"price_max":1675,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4996428202020,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTRACLETTE","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Raclette Pan with Burner Stand (k989)","public_title":null,"options":["Default Title"],"price":1675,"weight":0,"compare_at_price":null,"inventory_quantity":6,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250589989","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/raclettepanwithburner.jpg?v=1712864858","\/\/anvil.ie\/cdn\/shop\/products\/raclettepan.jpg?v=1712864858","\/\/anvil.ie\/cdn\/shop\/products\/raclette.jpg?v=1712864858"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/raclettepanwithburner.jpg?v=1712864858","options":["Title"],"media":[{"alt":null,"id":46275402858841,"position":2,"preview_image":{"aspect_ratio":1.0,"height":595,"width":595,"src":"\/\/anvil.ie\/cdn\/shop\/files\/raclettepanwithburner.jpg?v=1712864858"},"aspect_ratio":1.0,"height":595,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/raclettepanwithburner.jpg?v=1712864858","width":595},{"alt":null,"id":21164266684452,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/raclettepan.jpg?v=1712864858"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/raclettepan.jpg?v=1712864858","width":500},{"alt":null,"id":21164266717220,"position":4,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/raclette.jpg?v=1712864858"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/raclette.jpg?v=1712864858","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Perfect for a dinner party! This individual 9.5cm raclette with stand comes complete with burner, stand and wooden spatula, ideal for heating a variety of cheeses to spread over potatoes, gherkins and meat. A great dining accessory when enjoying an evening of fine artisan style dining and perfect for a romantic evening enjoying quality, homemade comforts. Raclette is handwash only. Wipe clean only the stand and burner once cool. Set includes: 1 x metal rack, 2 x tealights, 1 x wooden spatula \u0026amp; 1 x non-stick pan. Size: 8cm x 9.5cm x 19cm. Gift boxed"}
Artesà Raclette Pan with Burner Stand (k989)

Artesà Raclette Pan with Burner Stand (k989)

€16.75

Perfect for a dinner party! This individual 9.5cm raclette with stand comes complete with burner, stand and wooden spatula, ideal for heating a variety of cheeses to spread over potatoes, gherkins and meat. A great dining accessory when enjoying an evening of fine artisan style dining and perfect for a romantic evening enjoying quality, homemade...


More Info
{"id":6734127824932,"title":"Artesà Rectangular Cheese \u0026 Wine Pairing Slate Platter, 30cm (K406)","handle":"artesa-rectangular-slate-cheese-wine-pairing-platter","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eServe up some style at dinner parties and family feasts with this elegant slate cheese and wine pairing serving board. Make a stylish and informative statement when you’re next hosting a dinner party for friends and family with this elegant slate cheese pairing serving board from the Artesà range. The cheese board is beautifully illustrated with cheese and wine pairings. Measures 30 x 40 cm. Made from natural slate material. Wipe clean only. \u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-09-11T22:46:40+01:00","created_at":"2021-09-11T22:36:46+01:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":1295,"price_min":1295,"price_max":1295,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39578290880548,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTCHSPAIRING","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Rectangular Cheese \u0026 Wine Pairing Slate Platter, 30cm (K406)","public_title":null,"options":["Default Title"],"price":1295,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250794406","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/cheeseandwineslateboard_1.jpg?v=1632328585","\/\/anvil.ie\/cdn\/shop\/products\/cheeseandwineslateboard..jpg?v=1631396763"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/cheeseandwineslateboard_1.jpg?v=1632328585","options":["Title"],"media":[{"alt":null,"id":20916658110500,"position":1,"preview_image":{"aspect_ratio":1.256,"height":507,"width":637,"src":"\/\/anvil.ie\/cdn\/shop\/products\/cheeseandwineslateboard_1.jpg?v=1632328585"},"aspect_ratio":1.256,"height":507,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/cheeseandwineslateboard_1.jpg?v=1632328585","width":637},{"alt":null,"id":20875880726564,"position":2,"preview_image":{"aspect_ratio":1.408,"height":426,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/cheeseandwineslateboard..jpg?v=1631396763"},"aspect_ratio":1.408,"height":426,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/cheeseandwineslateboard..jpg?v=1631396763","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eServe up some style at dinner parties and family feasts with this elegant slate cheese and wine pairing serving board. Make a stylish and informative statement when you’re next hosting a dinner party for friends and family with this elegant slate cheese pairing serving board from the Artesà range. The cheese board is beautifully illustrated with cheese and wine pairings. Measures 30 x 40 cm. Made from natural slate material. Wipe clean only. \u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Rectangular Cheese & Wine Pairing Slate Platter, 30cm (K406)

Artesà Rectangular Cheese & Wine Pairing Slate Platter, 30cm (K406)

€12.95

Serve up some style at dinner parties and family feasts with this elegant slate cheese and wine pairing serving board. Make a stylish and informative statement when you’re next hosting a dinner party for friends and family with this elegant slate cheese pairing serving board from the Artesà range. The cheese board is beautifully illustrated wi...


More Info
{"id":6602013343780,"title":"Artesà Slate Serving Platter With Brushed Metal Handles, 60cm","handle":"artesa-appetiser-slate-serving-platter","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eShowcase a smorgasbord of antipasti, desserts or entrees with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal handles also make it easy to carry around to guests and also to use as a tray for serving individual dessert or dipping pots. Make a statement. Part of the Artesà range of hand finished dining and serving items. Wipe clean only. 5 year guarantee. Size: 60cm x 15cm. Includes: 1 x slate serving platter and 2 x metal handles. Gift boxed\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-05-02T12:38:33+01:00","created_at":"2021-05-02T12:33:18+01:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":2295,"price_min":2295,"price_max":2295,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39395178151972,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTPLATTER","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Slate Serving Platter With Brushed Metal Handles, 60cm","public_title":null,"options":["Default Title"],"price":2295,"weight":0,"compare_at_price":null,"inventory_quantity":10,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250480859","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/servinggrazingslateplatter_d653021f-6c99-44b2-b9b5-c3f86b0efe13.jpg?v=1712786979","\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTERservingplattergrazingplatter.jpg?v=1712786822","\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTER_10servingplattergrazingplatter.jpg?v=1712786822"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/servinggrazingslateplatter_d653021f-6c99-44b2-b9b5-c3f86b0efe13.jpg?v=1712786979","options":["Title"],"media":[{"alt":null,"id":46265629835609,"position":1,"preview_image":{"aspect_ratio":1.631,"height":544,"width":887,"src":"\/\/anvil.ie\/cdn\/shop\/files\/servinggrazingslateplatter_d653021f-6c99-44b2-b9b5-c3f86b0efe13.jpg?v=1712786979"},"aspect_ratio":1.631,"height":544,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/servinggrazingslateplatter_d653021f-6c99-44b2-b9b5-c3f86b0efe13.jpg?v=1712786979","width":887},{"alt":null,"id":20423758676004,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTERservingplattergrazingplatter.jpg?v=1712786822"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTERservingplattergrazingplatter.jpg?v=1712786822","width":500},{"alt":null,"id":20423758708772,"position":4,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTER_10servingplattergrazingplatter.jpg?v=1712786822"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTER_10servingplattergrazingplatter.jpg?v=1712786822","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eShowcase a smorgasbord of antipasti, desserts or entrees with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal handles also make it easy to carry around to guests and also to use as a tray for serving individual dessert or dipping pots. Make a statement. Part of the Artesà range of hand finished dining and serving items. Wipe clean only. 5 year guarantee. Size: 60cm x 15cm. Includes: 1 x slate serving platter and 2 x metal handles. Gift boxed\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Slate Serving Platter With Brushed Metal Handles, 60cm

Artesà Slate Serving Platter With Brushed Metal Handles, 60cm

€22.95

Showcase a smorgasbord of antipasti, desserts or entrees with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal handles also make it easy to carry around to guests and also to use as a tra...


More Info
{"id":6799040806948,"title":"Artesà Slate Serving Platter with Copper Handles, 60cm","handle":"artesa-hand-finished-serving-platter-with-copper-handles","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eArtesà Hand Finished Serving Platter with Copper Handles, 60cm. Showcase Artesà Hand Finished Serving Platter with Copper Handles, 60cm Artesà Hand Finished Serving Platter with Copper Handles, 60cm a smorgasbord of antipasti, desserts or entrées with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal copper coloured handles also make it easy to carry around to guests and also to use as a tray for serving individual dessert or dipping pots. Wipe clean only. Set includes: 1 x slate serving platter. 2 x copper handles. Size: 60cm x 15cm x 3.5cm. Gift boxed.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2021-11-01T22:41:03+00:00","created_at":"2021-11-01T22:34:39+00:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":2250,"price_min":2250,"price_max":2250,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39677677961252,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTPLATTERCOP","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Slate Serving Platter with Copper Handles, 60cm","public_title":null,"options":["Default Title"],"price":2250,"weight":0,"compare_at_price":null,"inventory_quantity":8,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250687401","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTERCOP_21slateservingplatter_1.jpg?v=1635806510","\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTERCOPslateservingplatter.jpg?v=1635806324","\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTERCOP_10slateservingplatter.jpg?v=1635806357"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTERCOP_21slateservingplatter_1.jpg?v=1635806510","options":["Title"],"media":[{"alt":null,"id":21106468225060,"position":1,"preview_image":{"aspect_ratio":1.408,"height":426,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTERCOP_21slateservingplatter_1.jpg?v=1635806510"},"aspect_ratio":1.408,"height":426,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTERCOP_21slateservingplatter_1.jpg?v=1635806510","width":600},{"alt":null,"id":21106460393508,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTERCOPslateservingplatter.jpg?v=1635806324"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTERCOPslateservingplatter.jpg?v=1635806324","width":600},{"alt":null,"id":21106462556196,"position":3,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTERCOP_10slateservingplatter.jpg?v=1635806357"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTPLATTERCOP_10slateservingplatter.jpg?v=1635806357","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eArtesà Hand Finished Serving Platter with Copper Handles, 60cm. Showcase Artesà Hand Finished Serving Platter with Copper Handles, 60cm Artesà Hand Finished Serving Platter with Copper Handles, 60cm a smorgasbord of antipasti, desserts or entrées with this natural slate serving platter. The natural black tone and uneven texturing adds a stylish backdrop for serving all manner of cold meats, cheese and fruit directly from the slate. The brushed twin metal copper coloured handles also make it easy to carry around to guests and also to use as a tray for serving individual dessert or dipping pots. Wipe clean only. Set includes: 1 x slate serving platter. 2 x copper handles. Size: 60cm x 15cm x 3.5cm. Gift boxed.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Slate Serving Platter with Copper Handles, 60cm

Artesà Slate Serving Platter with Copper Handles, 60cm

€22.50

Artesà Hand Finished Serving Platter with Copper Handles, 60cm. Showcase Artesà Hand Finished Serving Platter with Copper Handles, 60cm Artesà Hand Finished Serving Platter with Copper Handles, 60cm a smorgasbord of antipasti, desserts or entrées with this natural slate serving platter. The natural black tone and uneven texturing adds a stylis...


More Info
{"id":6845328883748,"title":"Artesà Stainless Steel Butter Knife, Rose Gold","handle":"artesa-stainless-steel-butter-knife-set","description":"Make a statement at the dinner table with these stylish, mirror polished butter knivfe. The perfect accompaniment to any side plate. An easy addition to the table top, it features etched detailing, sure to provoke admiring comments and appreciative glances. The stainless steel butter blade is a naturally cool material allowing you spread evenly across bread, toast and croissants. The warm rose gold handle sits in a harmonious fashion against the minimal steel. This beautiful butter knivfe sits apart from existing cutlery, adding a unique sophisticated twist to your serveware collection. Whether it's a dinner party or a celebration breakfast, it adds the perfect touch to your everyday and special occasion dining. \u003cspan data-mce-fragment=\"1\"\u003eSize: 12cm\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e","published_at":"2021-12-13T22:07:22+00:00","created_at":"2021-12-01T19:45:38+00:00","vendor":"Kitchencraft","type":"","tags":["TABLE \u0026 BAR"],"price":295,"price_min":295,"price_max":295,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39773684662308,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTBUTKNPK4","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Stainless Steel Butter Knife, Rose Gold","public_title":null,"options":["Default Title"],"price":295,"weight":0,"compare_at_price":null,"inventory_quantity":13,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250714190","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/butterknife.jpg?v=1638388128"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/butterknife.jpg?v=1638388128","options":["Title"],"media":[{"alt":null,"id":21294822817828,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/products\/butterknife.jpg?v=1638388128"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/butterknife.jpg?v=1638388128","width":700}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Make a statement at the dinner table with these stylish, mirror polished butter knivfe. The perfect accompaniment to any side plate. An easy addition to the table top, it features etched detailing, sure to provoke admiring comments and appreciative glances. The stainless steel butter blade is a naturally cool material allowing you spread evenly across bread, toast and croissants. The warm rose gold handle sits in a harmonious fashion against the minimal steel. This beautiful butter knivfe sits apart from existing cutlery, adding a unique sophisticated twist to your serveware collection. Whether it's a dinner party or a celebration breakfast, it adds the perfect touch to your everyday and special occasion dining. \u003cspan data-mce-fragment=\"1\"\u003eSize: 12cm\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e"}
Artesà Stainless Steel Butter Knife, Rose Gold

Artesà Stainless Steel Butter Knife, Rose Gold

€2.95

Make a statement at the dinner table with these stylish, mirror polished butter knivfe. The perfect accompaniment to any side plate. An easy addition to the table top, it features etched detailing, sure to provoke admiring comments and appreciative glances. The stainless steel butter blade is a naturally cool material allowing you spread evenly ...


More Info
{"id":4538504118308,"title":"Artesà Wood Antipasti Footed Serving Platter, 37cm","handle":"antipasti-wood-footed-serving-platter-medium","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eServe in style! The obvious choice for serving antipasti, tapas, entrees and desserts to friends and family, this large serving board adds a lovely natural contemporary feel to your evenings. The trendy plank adds an extra level to your table, it maximizes space and is ideal for serving food made to share. Hand finished acacia wood. Handwash only. 5 year guarantee.  Size: 37cm x 12cm x 13 cm. Gift boxed\u003cbr\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e","published_at":"2022-12-21T18:51:34+00:00","created_at":"2020-03-07T16:55:15+00:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT"],"price":3150,"price_min":3150,"price_max":3150,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":31740249112612,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTSBmed","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Artesà Wood Antipasti Footed Serving Platter, 37cm","public_title":null,"options":["Default Title"],"price":3150,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250520319","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/ARTSBMED_serving_platter_footed_2.jpg?v=1632328699","\/\/anvil.ie\/cdn\/shop\/products\/ARTSBMED_serving_platter_footed.jpg?v=1583600266"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/ARTSBMED_serving_platter_footed_2.jpg?v=1632328699","options":["Title"],"media":[{"alt":null,"id":6461184999460,"position":1,"preview_image":{"aspect_ratio":1.257,"height":389,"width":489,"src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTSBMED_serving_platter_footed_2.jpg?v=1632328699"},"aspect_ratio":1.257,"height":389,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTSBMED_serving_platter_footed_2.jpg?v=1632328699","width":489},{"alt":null,"id":6461185032228,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTSBMED_serving_platter_footed.jpg?v=1583600266"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/ARTSBMED_serving_platter_footed.jpg?v=1583600266","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eServe in style! The obvious choice for serving antipasti, tapas, entrees and desserts to friends and family, this large serving board adds a lovely natural contemporary feel to your evenings. The trendy plank adds an extra level to your table, it maximizes space and is ideal for serving food made to share. Hand finished acacia wood. Handwash only. 5 year guarantee.  Size: 37cm x 12cm x 13 cm. Gift boxed\u003cbr\u003e\u003cbr\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e"}
Artesà Wood Antipasti Footed Serving Platter, 37cm

Artesà Wood Antipasti Footed Serving Platter, 37cm

€31.50

Serve in style! The obvious choice for serving antipasti, tapas, entrees and desserts to friends and family, this large serving board adds a lovely natural contemporary feel to your evenings. The trendy plank adds an extra level to your table, it maximizes space and is ideal for serving food made to share. Hand finished acacia wood. Handwash o...


More Info
{"id":386571075620,"title":"ArtesàCheese Board \u0026 Knife Set, 35cm (k708)","handle":"artesa-cheese-platter-knife-set","description":"Serve a selection of beautiful cheeses to your guests in style! Ideal for presenting and enjoying a variety of cheeses, this set includes three different cheese knives and an elegant slate cheese board to make serving cheeses effortlessly stylish. A perfect gift for any keen cheese connoisseur. Slate is wipe clean only. Knives are handwash only 5 year guarantee. Not to be sold to persons under 18 years of age. Proof of age may be necessary. Set includes: 1 x slate serving platter, 1 x cheese serving knife, 1 x hard cheese knife \u0026amp; 1 x crumbly cheese knife. Size: 35cm x 25cm. Gift boxed.","published_at":"2022-02-01T11:57:10+00:00","created_at":"2017-11-23T14:14:03+00:00","vendor":"Kitchencraft","type":"","tags":["cheese boards","gifts for him","KITCHENCRAFT","TABLE \u0026 BAR"],"price":2995,"price_min":2995,"price_max":2995,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4996149182500,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"ARTCHEESESLAte","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"ArtesàCheese Board \u0026 Knife Set, 35cm (k708)","public_title":null,"options":["Default Title"],"price":2995,"weight":0,"compare_at_price":null,"inventory_quantity":15,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250603708","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/slatecheeseplatterwithknives..jpg?v=1637943009","\/\/anvil.ie\/cdn\/shop\/products\/slatecheeseplatterwithknives.jpg?v=1637942859","\/\/anvil.ie\/cdn\/shop\/products\/slatecheeseplatterwithknives2.jpg?v=1637942849"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/slatecheeseplatterwithknives..jpg?v=1637943009","options":["Title"],"media":[{"alt":null,"id":21263890022436,"position":1,"preview_image":{"aspect_ratio":1.217,"height":493,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/slatecheeseplatterwithknives..jpg?v=1637943009"},"aspect_ratio":1.217,"height":493,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/slatecheeseplatterwithknives..jpg?v=1637943009","width":600},{"alt":null,"id":21263890120740,"position":2,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/products\/slatecheeseplatterwithknives.jpg?v=1637942859"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/slatecheeseplatterwithknives.jpg?v=1637942859","width":700},{"alt":null,"id":21263890087972,"position":3,"preview_image":{"aspect_ratio":1.23,"height":488,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/slatecheeseplatterwithknives2.jpg?v=1637942849"},"aspect_ratio":1.23,"height":488,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/slatecheeseplatterwithknives2.jpg?v=1637942849","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Serve a selection of beautiful cheeses to your guests in style! Ideal for presenting and enjoying a variety of cheeses, this set includes three different cheese knives and an elegant slate cheese board to make serving cheeses effortlessly stylish. A perfect gift for any keen cheese connoisseur. Slate is wipe clean only. Knives are handwash only 5 year guarantee. Not to be sold to persons under 18 years of age. Proof of age may be necessary. Set includes: 1 x slate serving platter, 1 x cheese serving knife, 1 x hard cheese knife \u0026amp; 1 x crumbly cheese knife. Size: 35cm x 25cm. Gift boxed."}
ArtesàCheese Board & Knife Set, 35cm (k708)

ArtesàCheese Board & Knife Set, 35cm (k708)

€29.95

Serve a selection of beautiful cheeses to your guests in style! Ideal for presenting and enjoying a variety of cheeses, this set includes three different cheese knives and an elegant slate cheese board to make serving cheeses effortlessly stylish. A perfect gift for any keen cheese connoisseur. Slate is wipe clean only. Knives are handwash only ...


More Info
{"id":1449396928548,"title":"Bar Craft Lazy Fish Corkscrew (K008)","handle":"bar-craft-lazy-fish-corkscrew","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eWith a concertina mechanism for easy cork removal of even the most stubborn corks, this lazy fish corkscrew is based of an early 1900's design and uses a unique and innovative way of opening a bottle of wine! The lazyfish mechanism requires the minimum of effort to remove even the most stubborn of corks. The action finishes with a satisfying pop!  Wipe clean only. 5 year guarantee.\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2021-05-13T11:59:28+01:00","created_at":"2019-07-03T22:47:55+01:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":2395,"price_min":2395,"price_max":2395,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":11647059689508,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCLAZYFISH","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Bar Craft Lazy Fish Corkscrew (K008)","public_title":null,"options":["Default Title"],"price":2395,"weight":0,"compare_at_price":null,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250673008","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/BCLAZYFISH_lasy_fish_corkscrew_1.jpg?v=1638017218","\/\/anvil.ie\/cdn\/shop\/products\/BCLAZYFISH_lasy_fish_corkscrew_2.jpg?v=1638017218","\/\/anvil.ie\/cdn\/shop\/products\/BCLAZYFISH_lasy_fish_corkscrew_3.jpg?v=1638017218"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/BCLAZYFISH_lasy_fish_corkscrew_1.jpg?v=1638017218","options":["Title"],"media":[{"alt":null,"id":21270435659812,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/BCLAZYFISH_lasy_fish_corkscrew_1.jpg?v=1638017218"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/BCLAZYFISH_lasy_fish_corkscrew_1.jpg?v=1638017218","width":500},{"alt":null,"id":2495038455844,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/BCLAZYFISH_lasy_fish_corkscrew_2.jpg?v=1638017218"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/BCLAZYFISH_lasy_fish_corkscrew_2.jpg?v=1638017218","width":500},{"alt":null,"id":2495038488612,"position":3,"preview_image":{"aspect_ratio":1.0,"height":1417,"width":1417,"src":"\/\/anvil.ie\/cdn\/shop\/products\/BCLAZYFISH_lasy_fish_corkscrew_3.jpg?v=1638017218"},"aspect_ratio":1.0,"height":1417,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/BCLAZYFISH_lasy_fish_corkscrew_3.jpg?v=1638017218","width":1417}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv id=\"product-description\" class=\"content text-content product-padding product-description product-details-tab-container\"\u003eWith a concertina mechanism for easy cork removal of even the most stubborn corks, this lazy fish corkscrew is based of an early 1900's design and uses a unique and innovative way of opening a bottle of wine! The lazyfish mechanism requires the minimum of effort to remove even the most stubborn of corks. The action finishes with a satisfying pop!  Wipe clean only. 5 year guarantee.\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
Bar Craft Lazy Fish Corkscrew (K008)

Bar Craft Lazy Fish Corkscrew (K008)

€23.95

With a concertina mechanism for easy cork removal of even the most stubborn corks, this lazy fish corkscrew is based of an early 1900's design and uses a unique and innovative way of opening a bottle of wine! The lazyfish mechanism requires the minimum of effort to remove even the most stubborn of corks. The action finishes with a satisfying p...


More Info
{"id":1449412624420,"title":"Bar Craft Wine Aerator (K711)","handle":"bar-craft-wine-aerator","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eGood things come to those who wait. That's especially true when it comes to letting your wine breathe. But if you didn't have to wait, you probably wouldn't. With BarCraft's Plastic Wine Aerator you can cut straight to enjoying your wine's full flavour without the wait! This clever contraption works in really simple way. Pour in your wine, straight from the bottle. The wine aerator exposes it to oxygen as it flows through - instantly bringing out a depth of flavour you'd usually have to wait hours for if you decanted it. It's ideal for serving aged reds, some whites and even vintage ports. The 16-hole design catches any cork or wine sediment, so rather than a mouthful of grit, you can savour a smooth, harmonious blend of fruity notes! 12 month guarantee. Dishwasher safe\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2020-11-28T01:28:18+00:00","created_at":"2019-07-03T23:10:01+01:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":2350,"price_min":2350,"price_max":2350,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":11647105105956,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"bcaerpl","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Bar Craft Wine Aerator (K711)","public_title":null,"options":["Default Title"],"price":2350,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250742711","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/BCAERPL_wine_aerator.jpg?v=1712954088","\/\/anvil.ie\/cdn\/shop\/products\/BCAERPL_wine_aerator_2.jpg?v=1712954075"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/BCAERPL_wine_aerator.jpg?v=1712954088","options":["Title"],"media":[{"alt":null,"id":46289053679961,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/files\/BCAERPL_wine_aerator.jpg?v=1712954088"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/BCAERPL_wine_aerator.jpg?v=1712954088","width":600},{"alt":null,"id":2495055331364,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/BCAERPL_wine_aerator_2.jpg?v=1712954075"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/BCAERPL_wine_aerator_2.jpg?v=1712954075","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003e\n\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eGood things come to those who wait. That's especially true when it comes to letting your wine breathe. But if you didn't have to wait, you probably wouldn't. With BarCraft's Plastic Wine Aerator you can cut straight to enjoying your wine's full flavour without the wait! This clever contraption works in really simple way. Pour in your wine, straight from the bottle. The wine aerator exposes it to oxygen as it flows through - instantly bringing out a depth of flavour you'd usually have to wait hours for if you decanted it. It's ideal for serving aged reds, some whites and even vintage ports. The 16-hole design catches any cork or wine sediment, so rather than a mouthful of grit, you can savour a smooth, harmonious blend of fruity notes! 12 month guarantee. Dishwasher safe\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column\"\u003e\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
Bar Craft Wine Aerator (K711)

Bar Craft Wine Aerator (K711)

€23.50

Good things come to those who wait. That's especially true when it comes to letting your wine breathe. But if you didn't have to wait, you probably wouldn't. With BarCraft's Plastic Wine Aerator you can cut straight to enjoying your wine's full flavour without the wait! This clever contraption works in really simple way. Pour in your wine, ...


More Info
Sale
Barcraft 5 Piece Cocktail Tool Set (K28C)
{"id":386041741348,"title":"Barcraft 5 Piece Cocktail Tool Set (K28C)","handle":"luxe-lounge-5-piece-cocktail-tool-set","description":"This cocktail tool set contains everything you need to create the perfect cocktails right from the comfort of your own home, essential for serving a range of exquisite cocktails. Featuring inspirational recipes on the reverse, including Dry Martini, Caipirinha, Pina Colada and Mojito. Follow a recipe or use the tools to invent a refreshing drink. Set comprises: cocktail strainer, bottle opener, bar knife, stainless steel stand with clearly marked recipes on reverse. Gift boxed. Dishwasher safe. 12 month guarantee.","published_at":"2021-05-13T12:17:05+01:00","created_at":"2017-11-23T09:05:51+00:00","vendor":"Kitchencraft","type":"","tags":["50% Off","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":650,"price_min":650,"price_max":650,"available":true,"price_varies":false,"compare_at_price":1300,"compare_at_price_min":1300,"compare_at_price_max":1300,"compare_at_price_varies":false,"variants":[{"id":4992135397412,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCLLTOOL5PC","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Barcraft 5 Piece Cocktail Tool Set (K28C)","public_title":null,"options":["Default Title"],"price":650,"weight":0,"compare_at_price":1300,"inventory_quantity":6,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250427328","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/cocktailbartoolset..jpg?v=1636899758","\/\/anvil.ie\/cdn\/shop\/products\/cocktailbartoolset...jpg?v=1636899773","\/\/anvil.ie\/cdn\/shop\/products\/cocktailbartoolset.._da09b045-7e19-497a-90bf-ccef96d20588.jpg?v=1636899786","\/\/anvil.ie\/cdn\/shop\/products\/cocktailbartoolset._a883f703-5ae8-4508-8d89-4bbc8bf4e444.jpg?v=1636899719"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/cocktailbartoolset..jpg?v=1636899758","options":["Title"],"media":[{"alt":null,"id":21188048420900,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/products\/cocktailbartoolset..jpg?v=1636899758"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/cocktailbartoolset..jpg?v=1636899758","width":700},{"alt":null,"id":21188048453668,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/cocktailbartoolset...jpg?v=1636899773"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/cocktailbartoolset...jpg?v=1636899773","width":600},{"alt":null,"id":21188048486436,"position":3,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/cocktailbartoolset.._da09b045-7e19-497a-90bf-ccef96d20588.jpg?v=1636899786"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/cocktailbartoolset.._da09b045-7e19-497a-90bf-ccef96d20588.jpg?v=1636899786","width":600},{"alt":null,"id":21188048519204,"position":4,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/cocktailbartoolset._a883f703-5ae8-4508-8d89-4bbc8bf4e444.jpg?v=1636899719"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/cocktailbartoolset._a883f703-5ae8-4508-8d89-4bbc8bf4e444.jpg?v=1636899719","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"This cocktail tool set contains everything you need to create the perfect cocktails right from the comfort of your own home, essential for serving a range of exquisite cocktails. Featuring inspirational recipes on the reverse, including Dry Martini, Caipirinha, Pina Colada and Mojito. Follow a recipe or use the tools to invent a refreshing drink. Set comprises: cocktail strainer, bottle opener, bar knife, stainless steel stand with clearly marked recipes on reverse. Gift boxed. Dishwasher safe. 12 month guarantee."}
Barcraft 5 Piece Cocktail Tool Set (K28C)

Barcraft 5 Piece Cocktail Tool Set (K28C)

€6.50

This cocktail tool set contains everything you need to create the perfect cocktails right from the comfort of your own home, essential for serving a range of exquisite cocktails. Featuring inspirational recipes on the reverse, including Dry Martini, Caipirinha, Pina Colada and Mojito. Follow a recipe or use the tools to invent a refreshing drink...


More Info
Sale
BarCraft Brandy & Cognac Warmer Gift Set (K281)
{"id":6618080018468,"title":"BarCraft Brandy \u0026 Cognac Warmer Gift Set (K281)","handle":"barcraft-brandy-cognac-warmer-gift-set","description":"Create the perfect moment, relaxing with a warm glass of brandy. The only gift any brandy lover needs includes a snifter brandy glass, chrome stand and glass tealight holder. Pour a generous measure of your favourite brandy and place in the stand allowing the candle flame to gently warm your brandy to the perfect temperature. Then sit back and enjoy. 350ml capacity snifter glass.  Chrome warming stand.  Glass tealight holder. Candle not included. Glass is handwash only. Stand and tealight holder are wipe clean only","published_at":"2021-05-17T22:18:31+01:00","created_at":"2021-05-17T22:17:17+01:00","vendor":"Kitchencraft","type":"","tags":["**Offers**","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":1640,"price_min":1640,"price_max":1640,"available":true,"price_varies":false,"compare_at_price":2050,"compare_at_price_min":2050,"compare_at_price_max":2050,"compare_at_price_varies":false,"variants":[{"id":39416994725924,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCBWARMER","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Brandy \u0026 Cognac Warmer Gift Set (K281)","public_title":null,"options":["Default Title"],"price":1640,"weight":0,"compare_at_price":2050,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250849281","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/BCBWARMERbrandycognacwarmer.jpg?v=1621286305","\/\/anvil.ie\/cdn\/shop\/products\/BCBWARMER_10brandycognacwarmer.jpg?v=1621286305","\/\/anvil.ie\/cdn\/shop\/products\/BCBWARMER_22brandycognacwarmer.jpg?v=1621286305"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/BCBWARMERbrandycognacwarmer.jpg?v=1621286305","options":["Title"],"media":[{"alt":null,"id":20482144895012,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/BCBWARMERbrandycognacwarmer.jpg?v=1621286305"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/BCBWARMERbrandycognacwarmer.jpg?v=1621286305","width":500},{"alt":null,"id":20482144927780,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/BCBWARMER_10brandycognacwarmer.jpg?v=1621286305"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/BCBWARMER_10brandycognacwarmer.jpg?v=1621286305","width":500},{"alt":null,"id":20482144960548,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/BCBWARMER_22brandycognacwarmer.jpg?v=1621286305"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/BCBWARMER_22brandycognacwarmer.jpg?v=1621286305","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Create the perfect moment, relaxing with a warm glass of brandy. The only gift any brandy lover needs includes a snifter brandy glass, chrome stand and glass tealight holder. Pour a generous measure of your favourite brandy and place in the stand allowing the candle flame to gently warm your brandy to the perfect temperature. Then sit back and enjoy. 350ml capacity snifter glass.  Chrome warming stand.  Glass tealight holder. Candle not included. Glass is handwash only. Stand and tealight holder are wipe clean only"}
BarCraft Brandy & Cognac Warmer Gift Set (K281)

BarCraft Brandy & Cognac Warmer Gift Set (K281)

€16.40

Create the perfect moment, relaxing with a warm glass of brandy. The only gift any brandy lover needs includes a snifter brandy glass, chrome stand and glass tealight holder. Pour a generous measure of your favourite brandy and place in the stand allowing the candle flame to gently warm your brandy to the perfect temperature. Then sit back and e...


More Info
{"id":6618076971044,"title":"BarCraft Champagne \u0026 Prosecco Opener (K720)","handle":"barcraft-champagne-prosecco-opener","description":"Stainless steel opener slides easily over corks creating a secure hold when opening sparkling wines. By holding the cork firmly you are able to twist the bottle to slowly release the cork without wasting a drop. Solid stainless steel construction.  Dishwasher safe","published_at":"2021-05-17T22:16:37+01:00","created_at":"2021-05-17T22:14:58+01:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":750,"price_min":750,"price_max":750,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39416992071716,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCCHAMOP","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Champagne \u0026 Prosecco Opener (K720)","public_title":null,"options":["Default Title"],"price":750,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250818720","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/champagleproseccoopener_c286eb2f-33b1-4f68-a7e0-54491fd9c569.jpg?v=1712953569","\/\/anvil.ie\/cdn\/shop\/products\/BCCHAMOP_20champagneproseccoopener.jpg?v=1712953554"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/champagleproseccoopener_c286eb2f-33b1-4f68-a7e0-54491fd9c569.jpg?v=1712953569","options":["Title"],"media":[{"alt":null,"id":46288973070681,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/files\/champagleproseccoopener_c286eb2f-33b1-4f68-a7e0-54491fd9c569.jpg?v=1712953569"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/champagleproseccoopener_c286eb2f-33b1-4f68-a7e0-54491fd9c569.jpg?v=1712953569","width":500},{"alt":null,"id":20482137096228,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/BCCHAMOP_20champagneproseccoopener.jpg?v=1712953554"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/BCCHAMOP_20champagneproseccoopener.jpg?v=1712953554","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Stainless steel opener slides easily over corks creating a secure hold when opening sparkling wines. By holding the cork firmly you are able to twist the bottle to slowly release the cork without wasting a drop. Solid stainless steel construction.  Dishwasher safe"}
BarCraft Champagne & Prosecco Opener (K720)

BarCraft Champagne & Prosecco Opener (K720)

€7.50

Stainless steel opener slides easily over corks creating a secure hold when opening sparkling wines. By holding the cork firmly you are able to twist the bottle to slowly release the cork without wasting a drop. Solid stainless steel construction.  Dishwasher safe


More Info
{"id":384867041316,"title":"Barcraft Cocktail Shaker, 700ml (k74c)","handle":"glass-boston-cocktail-shaker-700ml","description":"Bar Craft cocktail shaker with a stainless steel lid and glass base. Features handy cocktail recipe markings on the outside, ideal for making your favourite cocktails. Recipes include Martini Dry, Rob Roy, Red Lion, Manhattan, Bronx, and Vodka Dry. Gift boxed.","published_at":"2021-02-17T00:13:20+00:00","created_at":"2017-11-22T10:55:06+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":2395,"price_min":2395,"price_max":2395,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4983946706980,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCBOSTON","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Barcraft Cocktail Shaker, 700ml (k74c)","public_title":null,"options":["Default Title"],"price":2395,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250139474","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/glasscocktailshaker.jpg?v=1636754279","\/\/anvil.ie\/cdn\/shop\/products\/glassbostoncocktailshaker..jpg?v=1636754249","\/\/anvil.ie\/cdn\/shop\/products\/glassbostoncocktailshaker.jpg?v=1636754265"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/glasscocktailshaker.jpg?v=1636754279","options":["Title"],"media":[{"alt":null,"id":21173789589540,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/glasscocktailshaker.jpg?v=1636754279"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/glasscocktailshaker.jpg?v=1636754279","width":600},{"alt":null,"id":21173789524004,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/glassbostoncocktailshaker..jpg?v=1636754249"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/glassbostoncocktailshaker..jpg?v=1636754249","width":500},{"alt":null,"id":21173789556772,"position":3,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/glassbostoncocktailshaker.jpg?v=1636754265"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/glassbostoncocktailshaker.jpg?v=1636754265","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Bar Craft cocktail shaker with a stainless steel lid and glass base. Features handy cocktail recipe markings on the outside, ideal for making your favourite cocktails. Recipes include Martini Dry, Rob Roy, Red Lion, Manhattan, Bronx, and Vodka Dry. Gift boxed."}
Barcraft Cocktail Shaker, 700ml (k74c)

Barcraft Cocktail Shaker, 700ml (k74c)

€23.95

Bar Craft cocktail shaker with a stainless steel lid and glass base. Features handy cocktail recipe markings on the outside, ideal for making your favourite cocktails. Recipes include Martini Dry, Rob Roy, Red Lion, Manhattan, Bronx, and Vodka Dry. Gift boxed.


More Info
Sold out
Barcraft Deluxe Wine Decanting Funnel (K629)
{"id":384837910564,"title":"Barcraft Deluxe Wine Decanting Funnel (K629)","handle":"decanting-funnel","description":"Connoisseur deluxe stylish and durable stainless steel decanting funnel, complete with an aerating nozzle, removable fine mesh filter, decanting stand, and drip tray, for effective and easy decanting time and again. Dishwasher safe. Gift boxed.","published_at":"2020-11-04T11:25:12+00:00","created_at":"2017-11-22T10:29:46+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":2295,"price_min":2295,"price_max":2295,"available":false,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4983702159396,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"kcbcfunnel","requires_shipping":true,"taxable":true,"featured_image":null,"available":false,"name":"Barcraft Deluxe Wine Decanting Funnel (K629)","public_title":null,"options":["Default Title"],"price":2295,"weight":0,"compare_at_price":null,"inventory_quantity":0,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250135629","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/kitchencraftdecantingfunnel_2.jpg?v=1636465238","\/\/anvil.ie\/cdn\/shop\/products\/kitchencraftdecantingfunnel._1.jpg?v=1636465098","\/\/anvil.ie\/cdn\/shop\/products\/kitchencraftdecantingfunnel_1.jpg?v=1636465112"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/kitchencraftdecantingfunnel_2.jpg?v=1636465238","options":["Title"],"media":[{"alt":null,"id":21147092025380,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/kitchencraftdecantingfunnel_2.jpg?v=1636465238"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/kitchencraftdecantingfunnel_2.jpg?v=1636465238","width":600},{"alt":null,"id":21147085701156,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/kitchencraftdecantingfunnel._1.jpg?v=1636465098"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/kitchencraftdecantingfunnel._1.jpg?v=1636465098","width":500},{"alt":null,"id":21147085733924,"position":3,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/kitchencraftdecantingfunnel_1.jpg?v=1636465112"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/kitchencraftdecantingfunnel_1.jpg?v=1636465112","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Connoisseur deluxe stylish and durable stainless steel decanting funnel, complete with an aerating nozzle, removable fine mesh filter, decanting stand, and drip tray, for effective and easy decanting time and again. Dishwasher safe. Gift boxed."}
Barcraft Deluxe Wine Decanting Funnel (K629)

Barcraft Deluxe Wine Decanting Funnel (K629)

€22.95

Connoisseur deluxe stylish and durable stainless steel decanting funnel, complete with an aerating nozzle, removable fine mesh filter, decanting stand, and drip tray, for effective and easy decanting time and again. Dishwasher safe. Gift boxed.


More Info
{"id":8588986417497,"title":"BarCraft Hammered-Steel Textured Cocktail Shaker, 700ml","handle":"barcraft-hammered-steel-textured-cocktail-shaker-700ml","description":"This stainless steel cocktail shaker sees the classic ‘cobbler’ design given a new lease of life with a gorgeous, hammered-effect finish. Unique and timeless, it’s exactly what you need to take your cocktail shaking from amateur, to professional. Underneath this modern upgrade, though, it’s the same, high-quality shaker that’s been favoured by mixologists for decades. Features like a rust-resistant stainless steel body and a built-in strainer lid, it promises years of enjoyable cocktail making. Food-grade stainless steel. 700 ml capacity. Handwash only","published_at":"2023-11-25T23:41:02+00:00","created_at":"2023-11-25T23:39:34+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":2495,"price_min":2495,"price_max":2495,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":47420090581337,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCCSHAKHAM","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Hammered-Steel Textured Cocktail Shaker, 700ml","public_title":null,"options":["Default Title"],"price":2495,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250796509","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/cocktailshaker.jpg?v=1700955862","\/\/anvil.ie\/cdn\/shop\/files\/cocktailshaker._c3d314a6-002b-42c7-84a4-c81a940716fc.jpg?v=1700955843"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/cocktailshaker.jpg?v=1700955862","options":["Title"],"media":[{"alt":null,"id":44514911977817,"position":1,"preview_image":{"aspect_ratio":0.864,"height":700,"width":605,"src":"\/\/anvil.ie\/cdn\/shop\/files\/cocktailshaker.jpg?v=1700955862"},"aspect_ratio":0.864,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/cocktailshaker.jpg?v=1700955862","width":605},{"alt":null,"id":44514924724569,"position":2,"preview_image":{"aspect_ratio":1.1,"height":502,"width":552,"src":"\/\/anvil.ie\/cdn\/shop\/files\/cocktailshaker._c3d314a6-002b-42c7-84a4-c81a940716fc.jpg?v=1700955843"},"aspect_ratio":1.1,"height":502,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/cocktailshaker._c3d314a6-002b-42c7-84a4-c81a940716fc.jpg?v=1700955843","width":552}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"This stainless steel cocktail shaker sees the classic ‘cobbler’ design given a new lease of life with a gorgeous, hammered-effect finish. Unique and timeless, it’s exactly what you need to take your cocktail shaking from amateur, to professional. Underneath this modern upgrade, though, it’s the same, high-quality shaker that’s been favoured by mixologists for decades. Features like a rust-resistant stainless steel body and a built-in strainer lid, it promises years of enjoyable cocktail making. Food-grade stainless steel. 700 ml capacity. Handwash only"}
BarCraft Hammered-Steel Textured Cocktail Shaker, 700ml

BarCraft Hammered-Steel Textured Cocktail Shaker, 700ml

€24.95

This stainless steel cocktail shaker sees the classic ‘cobbler’ design given a new lease of life with a gorgeous, hammered-effect finish. Unique and timeless, it’s exactly what you need to take your cocktail shaking from amateur, to professional. Underneath this modern upgrade, though, it’s the same, high-quality shaker that’s been favoured by m...


More Info
{"id":6934017474596,"title":"BarCraft Multi Measure Cocktail Jigger (28LB)","handle":"barcraft-multi-measure-cocktail-jigger","description":"Use the jigger to measure your shots (25ml and 50ml) when preparing gorgeous cocktails. Ideal for accurately measuring spirits for cocktails and mixes, and made from durable stainless steel. Handwash. Measures 25ml and 50ml\u003cbr data-mce-fragment=\"1\"\u003e","published_at":"2022-02-01T20:54:50+00:00","created_at":"2022-02-01T20:50:30+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":895,"price_min":895,"price_max":895,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":39991569055780,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCLLJIG","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Multi Measure Cocktail Jigger (28LB)","public_title":null,"options":["Default Title"],"price":895,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250583628","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/coppereffectspiritmeasurejigger_664a5a81-618d-4093-bd9d-bf7761245df0.jpg?v=1712956102","\/\/anvil.ie\/cdn\/shop\/products\/BCLLJIGcocktailjiggermeasure._2.jpg?v=1712956102"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/coppereffectspiritmeasurejigger_664a5a81-618d-4093-bd9d-bf7761245df0.jpg?v=1712956102","options":["Title"],"media":[{"alt":null,"id":46289399251289,"position":1,"preview_image":{"aspect_ratio":1.0,"height":539,"width":539,"src":"\/\/anvil.ie\/cdn\/shop\/files\/coppereffectspiritmeasurejigger_664a5a81-618d-4093-bd9d-bf7761245df0.jpg?v=1712956102"},"aspect_ratio":1.0,"height":539,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/coppereffectspiritmeasurejigger_664a5a81-618d-4093-bd9d-bf7761245df0.jpg?v=1712956102","width":539},{"alt":null,"id":21738898948132,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/BCLLJIGcocktailjiggermeasure._2.jpg?v=1712956102"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/BCLLJIGcocktailjiggermeasure._2.jpg?v=1712956102","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Use the jigger to measure your shots (25ml and 50ml) when preparing gorgeous cocktails. Ideal for accurately measuring spirits for cocktails and mixes, and made from durable stainless steel. Handwash. Measures 25ml and 50ml\u003cbr data-mce-fragment=\"1\"\u003e"}
BarCraft Multi Measure Cocktail Jigger (28LB)

BarCraft Multi Measure Cocktail Jigger (28LB)

€8.95

Use the jigger to measure your shots (25ml and 50ml) when preparing gorgeous cocktails. Ideal for accurately measuring spirits for cocktails and mixes, and made from durable stainless steel. Handwash. Measures 25ml and 50ml


More Info
{"id":383775572004,"title":"Barcraft Rotary Action Acrylic Ice Crusher (k004)","handle":"rotary-action-acrylic-ice-crusher","description":"BarCraft deluxe retro style ice crusher with an easy to use rotary action, large clear acrylic collecting box and matching ice scoop. Create crushed ice as and when you need it to serve perfectly cool drinks and cocktails. Everyday essentials for the bar at home, BarCraft offers a selection of bar essentials to bring the fun inside your home. Covering wine, cocktails, spirits and so much more, BarCraft is the perfect choice when wanting to relax at home, feeling refreshed and revitalised. Handwash only\u003cbr\u003e\u003cbr\u003e","published_at":"2020-11-05T12:34:16+00:00","created_at":"2017-11-21T17:05:08+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":4795,"price_min":4795,"price_max":4795,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4975463399460,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCICECR","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Barcraft Rotary Action Acrylic Ice Crusher (k004)","public_title":null,"options":["Default Title"],"price":4795,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250150004","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/icecrusher.jpg?v=1636753003","\/\/anvil.ie\/cdn\/shop\/products\/kitchencrafticecrusher.jpg?v=1636753023"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/icecrusher.jpg?v=1636753003","options":["Title"],"media":[{"alt":null,"id":21173632729124,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/icecrusher.jpg?v=1636753003"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/icecrusher.jpg?v=1636753003","width":600},{"alt":null,"id":21173632696356,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/kitchencrafticecrusher.jpg?v=1636753023"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/kitchencrafticecrusher.jpg?v=1636753023","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"BarCraft deluxe retro style ice crusher with an easy to use rotary action, large clear acrylic collecting box and matching ice scoop. Create crushed ice as and when you need it to serve perfectly cool drinks and cocktails. Everyday essentials for the bar at home, BarCraft offers a selection of bar essentials to bring the fun inside your home. Covering wine, cocktails, spirits and so much more, BarCraft is the perfect choice when wanting to relax at home, feeling refreshed and revitalised. Handwash only\u003cbr\u003e\u003cbr\u003e"}
Barcraft Rotary Action Acrylic Ice Crusher (k004)

Barcraft Rotary Action Acrylic Ice Crusher (k004)

€47.95

BarCraft deluxe retro style ice crusher with an easy to use rotary action, large clear acrylic collecting box and matching ice scoop. Create crushed ice as and when you need it to serve perfectly cool drinks and cocktails. Everyday essentials for the bar at home, BarCraft offers a selection of bar essentials to bring the fun inside your home. Co...


More Info
{"id":1449410592804,"title":"BarCraft Shot Measure \u0026 Pourer (k481)","handle":"bar-craft-shot-measure-pourer","description":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eAn essential for mixing cocktails and drinks, this BarCraft shot measure and pourer provides a single shot measure and attaches easily to any bottle top. A must-have bar accessory.\u003cspan\u003e \u003c\/span\u003eHandwash only. 12 month guarantee\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e","published_at":"2021-05-13T12:05:35+01:00","created_at":"2019-07-03T23:06:09+01:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","WINE \u0026 BAR"],"price":795,"price_min":795,"price_max":795,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":11647100125220,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"kcbcshot","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Shot Measure \u0026 Pourer (k481)","public_title":null,"options":["Default Title"],"price":795,"weight":0,"compare_at_price":null,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250139481","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/kcbcshot_shot_measure.jpg?v=1712951690","\/\/anvil.ie\/cdn\/shop\/files\/shotmeasure.jpg?v=1712951764"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/kcbcshot_shot_measure.jpg?v=1712951690","options":["Title"],"media":[{"alt":null,"id":46288661479769,"position":1,"preview_image":{"aspect_ratio":1.0,"height":624,"width":624,"src":"\/\/anvil.ie\/cdn\/shop\/files\/kcbcshot_shot_measure.jpg?v=1712951690"},"aspect_ratio":1.0,"height":624,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/kcbcshot_shot_measure.jpg?v=1712951690","width":624},{"alt":null,"id":46288669442393,"position":2,"preview_image":{"aspect_ratio":0.881,"height":681,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/files\/shotmeasure.jpg?v=1712951764"},"aspect_ratio":0.881,"height":681,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/shotmeasure.jpg?v=1712951764","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cdiv id=\"product-details-tabs\"\u003e\n\u003cdiv class=\"product-details-tab-wrapper\"\u003e\n\u003cdiv class=\"content text-content product-padding product-description product-details-tab-container\" id=\"product-description\"\u003eAn essential for mixing cocktails and drinks, this BarCraft shot measure and pourer provides a single shot measure and attaches easily to any bottle top. A must-have bar accessory.\u003cspan\u003e \u003c\/span\u003eHandwash only. 12 month guarantee\u003c\/div\u003e\n\u003c\/div\u003e\n\u003c\/div\u003e"}
BarCraft Shot Measure & Pourer (k481)

BarCraft Shot Measure & Pourer (k481)

€7.95

An essential for mixing cocktails and drinks, this BarCraft shot measure and pourer provides a single shot measure and attaches easily to any bottle top. A must-have bar accessory. Handwash only. 12 month guarantee


More Info
{"id":385084784676,"title":"Barcraft Stainless Steel Cocktail Compass (k734)","handle":"luxe-lounge-stainless-steel-cocktail-compass","description":"Perfect the art of cocktails with this Luxe Lounge stainless steel cocktail compass. Spin to reveal twelve cocktail recipes including cosmopolitan, long island ice tea, margarita and mojito. All there is left to do for you is to follow the recipe and enjoy your delicious cocktails. Luxe Lounge from Bar Craft – the art deco inspired cocktail collection for luxurious lounge living at home. Wipe clean only. 12 month guarantee.","published_at":"2022-02-01T14:19:25+00:00","created_at":"2017-11-22T14:30:01+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":1195,"price_min":1195,"price_max":1195,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4985303040036,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"bcllcompass","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Barcraft Stainless Steel Cocktail Compass (k734)","public_title":null,"options":["Default Title"],"price":1195,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250426734","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/kitchencraftcocktaildrinkscompass._2290f049-a022-4b91-9178-3b75b20ccd35.jpg?v=1712953157","\/\/anvil.ie\/cdn\/shop\/files\/stainlesssteelcocktailcompass.jpg?v=1712953141","\/\/anvil.ie\/cdn\/shop\/files\/kitchencraftcocktaildrinkscompass..jpg?v=1712953171"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/kitchencraftcocktaildrinkscompass._2290f049-a022-4b91-9178-3b75b20ccd35.jpg?v=1712953157","options":["Title"],"media":[{"alt":null,"id":46288898982233,"position":2,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/files\/kitchencraftcocktaildrinkscompass._2290f049-a022-4b91-9178-3b75b20ccd35.jpg?v=1712953157"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/kitchencraftcocktaildrinkscompass._2290f049-a022-4b91-9178-3b75b20ccd35.jpg?v=1712953157","width":700},{"alt":null,"id":46288873521497,"position":3,"preview_image":{"aspect_ratio":0.667,"height":600,"width":400,"src":"\/\/anvil.ie\/cdn\/shop\/files\/stainlesssteelcocktailcompass.jpg?v=1712953141"},"aspect_ratio":0.667,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/stainlesssteelcocktailcompass.jpg?v=1712953141","width":400},{"alt":null,"id":46288887120217,"position":4,"preview_image":{"aspect_ratio":1.007,"height":695,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/files\/kitchencraftcocktaildrinkscompass..jpg?v=1712953171"},"aspect_ratio":1.007,"height":695,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/kitchencraftcocktaildrinkscompass..jpg?v=1712953171","width":700}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Perfect the art of cocktails with this Luxe Lounge stainless steel cocktail compass. Spin to reveal twelve cocktail recipes including cosmopolitan, long island ice tea, margarita and mojito. All there is left to do for you is to follow the recipe and enjoy your delicious cocktails. Luxe Lounge from Bar Craft – the art deco inspired cocktail collection for luxurious lounge living at home. Wipe clean only. 12 month guarantee."}
Barcraft Stainless Steel Cocktail Compass (k734)

Barcraft Stainless Steel Cocktail Compass (k734)

€11.95

Perfect the art of cocktails with this Luxe Lounge stainless steel cocktail compass. Spin to reveal twelve cocktail recipes including cosmopolitan, long island ice tea, margarita and mojito. All there is left to do for you is to follow the recipe and enjoy your delicious cocktails. Luxe Lounge from Bar Craft – the art deco inspired cocktail col...


More Info
{"id":383775408164,"title":"Barcraft Stainless Steel Ice Serving Tongs (k54a)","handle":"stainless-steel-ice-serving-tongs","description":"These ice tongs offer an easy way to serve a precise amount of ice while keeping your fingers away from the icy coldness. They’re hygienic too, because your fingers don’t have to get involved. And there’s less chance of mess, because the tongs have ridged heads that grip firmly onto ice, for easy transfer from container to glass. Made of robust, high-quality stainless steel, they’ll provide long-lasting party fun, and have a handsome brushed finish that will add a professional touch to your home bar.\u003cbr\u003e","published_at":"2020-11-05T12:25:09+00:00","created_at":"2017-11-21T17:05:00+00:00","vendor":"Kitchencraft","type":"","tags":["KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":395,"price_min":395,"price_max":395,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4975462580260,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCTONGS","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Barcraft Stainless Steel Ice Serving Tongs (k54a)","public_title":null,"options":["Default Title"],"price":395,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250144454","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/ICESERVINGTONGS.jpg?v=1686118969"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/ICESERVINGTONGS.jpg?v=1686118969","options":["Title"],"media":[{"alt":null,"id":42724964761945,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/files\/ICESERVINGTONGS.jpg?v=1686118969"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/ICESERVINGTONGS.jpg?v=1686118969","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"These ice tongs offer an easy way to serve a precise amount of ice while keeping your fingers away from the icy coldness. They’re hygienic too, because your fingers don’t have to get involved. And there’s less chance of mess, because the tongs have ridged heads that grip firmly onto ice, for easy transfer from container to glass. Made of robust, high-quality stainless steel, they’ll provide long-lasting party fun, and have a handsome brushed finish that will add a professional touch to your home bar.\u003cbr\u003e"}
Barcraft Stainless Steel Ice Serving Tongs (k54a)

Barcraft Stainless Steel Ice Serving Tongs (k54a)

€3.95

These ice tongs offer an easy way to serve a precise amount of ice while keeping your fingers away from the icy coldness. They’re hygienic too, because your fingers don’t have to get involved. And there’s less chance of mess, because the tongs have ridged heads that grip firmly onto ice, for easy transfer from container to glass. Made of robust,...


More Info
{"id":8569069240665,"title":"BarCraft Stainless Steel Mixing Spoon, 28cm","handle":"barcraft-stainless-steel-mixing-spoon-28cm","description":"No bar's complete without a high-quality cocktail mixing spoon - not even your home bar. With a professional-quality bar spoon, like this BarCraft version, you'll have no trouble stirring your way to perfect Old Fashioned, Sezerac and Martini cocktails. Its long twisted handle makes it ideal for stirring ingredients round tall mixing glasses, or large pitchers (when you're really celebrating!). This bar spoon also features a round flat end, which makes it easy to mash ingredients when you've not got a muddler to hand. Made of durable stainless steel, it's rust-resistant, easy to clean and gives off the kind of polished shimmer that's sure to catch the eye. So. whether you're a keen mixologist, a professional bartender or a budding beginner: you can rest assured this cocktail mixing spoon will serve you well for years to come. Dishwasher safe","published_at":"2023-11-06T21:46:45+00:00","created_at":"2023-11-06T21:42:42+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":850,"price_min":850,"price_max":850,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":47335636992345,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCLLMIXSP","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Stainless Steel Mixing Spoon, 28cm","public_title":null,"options":["Default Title"],"price":850,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250436610","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/cocktailmixingspoon.jpg?v=1699307117","\/\/anvil.ie\/cdn\/shop\/files\/cocktailmixingspoon..jpg?v=1699307130"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/cocktailmixingspoon.jpg?v=1699307117","options":["Title"],"media":[{"alt":null,"id":44312823071065,"position":1,"preview_image":{"aspect_ratio":1.254,"height":558,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/files\/cocktailmixingspoon.jpg?v=1699307117"},"aspect_ratio":1.254,"height":558,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/cocktailmixingspoon.jpg?v=1699307117","width":700},{"alt":null,"id":44312823038297,"position":2,"preview_image":{"aspect_ratio":1.478,"height":406,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/files\/cocktailmixingspoon..jpg?v=1699307130"},"aspect_ratio":1.478,"height":406,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/cocktailmixingspoon..jpg?v=1699307130","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"No bar's complete without a high-quality cocktail mixing spoon - not even your home bar. With a professional-quality bar spoon, like this BarCraft version, you'll have no trouble stirring your way to perfect Old Fashioned, Sezerac and Martini cocktails. Its long twisted handle makes it ideal for stirring ingredients round tall mixing glasses, or large pitchers (when you're really celebrating!). This bar spoon also features a round flat end, which makes it easy to mash ingredients when you've not got a muddler to hand. Made of durable stainless steel, it's rust-resistant, easy to clean and gives off the kind of polished shimmer that's sure to catch the eye. So. whether you're a keen mixologist, a professional bartender or a budding beginner: you can rest assured this cocktail mixing spoon will serve you well for years to come. Dishwasher safe"}
BarCraft Stainless Steel Mixing Spoon, 28cm

BarCraft Stainless Steel Mixing Spoon, 28cm

€8.50

No bar's complete without a high-quality cocktail mixing spoon - not even your home bar. With a professional-quality bar spoon, like this BarCraft version, you'll have no trouble stirring your way to perfect Old Fashioned, Sezerac and Martini cocktails. Its long twisted handle makes it ideal for stirring ingredients round tall mixing glasses, or...


More Info
{"id":4607597445156,"title":"BarCraft Stainless Steel Wine Pourer with Stopper (kc13d)","handle":"barcraft-stainless-steel-wine-pourer-with-stopper","description":"Stylish, two in one stainless steel bottle pourer to stop dripping wine and a removable bottle stopper to keep wine fresh when not in use. Fits most wine bottles. Handwash only. 12 month guarantee","published_at":"2021-05-13T12:03:45+01:00","created_at":"2020-04-25T14:42:13+01:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":495,"price_min":495,"price_max":495,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":31891406323748,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCPOURCD","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Stainless Steel Wine Pourer with Stopper (kc13d)","public_title":null,"options":["Default Title"],"price":495,"weight":0,"compare_at_price":null,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250148513","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/KCBCPOURCDwinepourerandstopper2.jpg?v=1587822190","\/\/anvil.ie\/cdn\/shop\/products\/KCBCPOURCDwinepourerandstopper.jpg?v=1587822190"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/KCBCPOURCDwinepourerandstopper2.jpg?v=1587822190","options":["Title"],"media":[{"alt":null,"id":6667989221412,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/KCBCPOURCDwinepourerandstopper2.jpg?v=1587822190"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/KCBCPOURCDwinepourerandstopper2.jpg?v=1587822190","width":500},{"alt":null,"id":6667989254180,"position":2,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/KCBCPOURCDwinepourerandstopper.jpg?v=1587822190"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/KCBCPOURCDwinepourerandstopper.jpg?v=1587822190","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Stylish, two in one stainless steel bottle pourer to stop dripping wine and a removable bottle stopper to keep wine fresh when not in use. Fits most wine bottles. Handwash only. 12 month guarantee"}
BarCraft Stainless Steel Wine Pourer with Stopper (kc13d)

BarCraft Stainless Steel Wine Pourer with Stopper (kc13d)

€4.95

Stylish, two in one stainless steel bottle pourer to stop dripping wine and a removable bottle stopper to keep wine fresh when not in use. Fits most wine bottles. Handwash only. 12 month guarantee


More Info
{"id":7213062783012,"title":"BarCraft Wine \u0026 Champagne Sealer","handle":"barcraft-wine-champagne-sealer","description":"This airtight Wine and Champagne Sealer from BarCraft preserves bubbles and keeps drinks fresher for longer. Simply place the device onto an open bottle, press down to secure it and turn the knob clockwise until the seal is tight to create a vacuum-seal. The champagne sealer fits most standard-sized wine and champagne bottles and allows for horizontal storage. Measurements: 4.5cm x 6cm\u0026amp;nbsp;","published_at":"2022-12-13T20:19:15+00:00","created_at":"2022-12-13T20:16:15+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":950,"price_min":950,"price_max":950,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":40545843871780,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCCHAMSEAL","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"BarCraft Wine \u0026 Champagne Sealer","public_title":null,"options":["Default Title"],"price":950,"weight":0,"compare_at_price":null,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5057982087180","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/winechampagnesealer.webp?v=1670962741","\/\/anvil.ie\/cdn\/shop\/products\/winechampagnesealer.jpg?v=1670962741","\/\/anvil.ie\/cdn\/shop\/products\/winechampagnesealer_c89bbe20-4fcb-48af-905b-092d9707e147.jpg?v=1670962739"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/winechampagnesealer.webp?v=1670962741","options":["Title"],"media":[{"alt":null,"id":23294988386340,"position":1,"preview_image":{"aspect_ratio":1.0,"height":640,"width":640,"src":"\/\/anvil.ie\/cdn\/shop\/products\/winechampagnesealer.webp?v=1670962741"},"aspect_ratio":1.0,"height":640,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/winechampagnesealer.webp?v=1670962741","width":640},{"alt":null,"id":23294988353572,"position":2,"preview_image":{"aspect_ratio":1.0,"height":640,"width":640,"src":"\/\/anvil.ie\/cdn\/shop\/products\/winechampagnesealer.jpg?v=1670962741"},"aspect_ratio":1.0,"height":640,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/winechampagnesealer.jpg?v=1670962741","width":640},{"alt":null,"id":23294988419108,"position":3,"preview_image":{"aspect_ratio":1.499,"height":427,"width":640,"src":"\/\/anvil.ie\/cdn\/shop\/products\/winechampagnesealer_c89bbe20-4fcb-48af-905b-092d9707e147.jpg?v=1670962739"},"aspect_ratio":1.499,"height":427,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/winechampagnesealer_c89bbe20-4fcb-48af-905b-092d9707e147.jpg?v=1670962739","width":640}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"This airtight Wine and Champagne Sealer from BarCraft preserves bubbles and keeps drinks fresher for longer. Simply place the device onto an open bottle, press down to secure it and turn the knob clockwise until the seal is tight to create a vacuum-seal. The champagne sealer fits most standard-sized wine and champagne bottles and allows for horizontal storage. Measurements: 4.5cm x 6cm\u0026amp;nbsp;"}
BarCraft Wine & Champagne Sealer

BarCraft Wine & Champagne Sealer

€9.50

This airtight Wine and Champagne Sealer from BarCraft preserves bubbles and keeps drinks fresher for longer. Simply place the device onto an open bottle, press down to secure it and turn the knob clockwise until the seal is tight to create a vacuum-seal. The champagne sealer fits most standard-sized wine and champagne bottles and allows for hori...


More Info
Sale
Barcraft Wine Bottle Thermometer Sleeve (k79a)
{"id":383774162980,"title":"Barcraft Wine Bottle Thermometer Sleeve (k79a)","handle":"wine-bottle-thermometer-sleeve","description":"Bar Craft easy to use wine thermometer and guide. Simply slip the thermometer sleeve over the bottle and the temperature lights up on the sleeve. Suitable for red and white wine, with suggested temperatures for most wines. Wipe clean only. Gift boxed","published_at":"2020-12-11T12:42:56+00:00","created_at":"2017-11-21T17:03:56+00:00","vendor":"Kitchencraft","type":"","tags":["50% Off","KITCHENCRAFT","KITCHENWARE DUBLIN","KITCHENWARE IRELAND","KITCHENWARE WICKLOW","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":695,"price_min":695,"price_max":695,"available":true,"price_varies":false,"compare_at_price":1050,"compare_at_price_min":1050,"compare_at_price_max":1050,"compare_at_price_varies":false,"variants":[{"id":4975451832356,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"KCBCTHERM","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Barcraft Wine Bottle Thermometer Sleeve (k79a)","public_title":null,"options":["Default Title"],"price":695,"weight":0,"compare_at_price":1050,"inventory_quantity":5,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5028250135650","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/Winebottlethermometersleeve_1_8f26d613-b5dc-4486-91de-901f3ff28134.jpg?v=1671646784","\/\/anvil.ie\/cdn\/shop\/products\/winebottlethermometer_8016b994-92e6-4cf7-b22a-8f189b20719c.jpg?v=1671645255","\/\/anvil.ie\/cdn\/shop\/products\/winebottlethermometersleeve._1_1.jpg?v=1671645255"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/Winebottlethermometersleeve_1_8f26d613-b5dc-4486-91de-901f3ff28134.jpg?v=1671646784","options":["Title"],"media":[{"alt":null,"id":23324983590948,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/Winebottlethermometersleeve_1_8f26d613-b5dc-4486-91de-901f3ff28134.jpg?v=1671646784"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/Winebottlethermometersleeve_1_8f26d613-b5dc-4486-91de-901f3ff28134.jpg?v=1671646784","width":600},{"alt":null,"id":21157664948260,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/winebottlethermometer_8016b994-92e6-4cf7-b22a-8f189b20719c.jpg?v=1671645255"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/winebottlethermometer_8016b994-92e6-4cf7-b22a-8f189b20719c.jpg?v=1671645255","width":600},{"alt":null,"id":23174139772964,"position":3,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/products\/winebottlethermometersleeve._1_1.jpg?v=1671645255"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/winebottlethermometersleeve._1_1.jpg?v=1671645255","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Bar Craft easy to use wine thermometer and guide. Simply slip the thermometer sleeve over the bottle and the temperature lights up on the sleeve. Suitable for red and white wine, with suggested temperatures for most wines. Wipe clean only. Gift boxed"}
Barcraft Wine Bottle Thermometer Sleeve (k79a)

Barcraft Wine Bottle Thermometer Sleeve (k79a)

€6.95

Bar Craft easy to use wine thermometer and guide. Simply slip the thermometer sleeve over the bottle and the temperature lights up on the sleeve. Suitable for red and white wine, with suggested temperatures for most wines. Wipe clean only. Gift boxed


More Info
Sold out
BarCraft Winged Corkscrew, Black
{"id":8569071108441,"title":"BarCraft Winged Corkscrew, Black","handle":"barcraft-winged-corkscrew-black","description":"This heavy-duty Winged Corkscrew with bottle opener from BarCraft grips tightly to wine bottles and easily removes corks without crumbling. Made of a durable zinc alloy, it’s carefully crafted to combine modern design and stability. The non-stick spiral enables a clean removal, extracting the cork in one piece. To use, simply squeeze the winged corkscrew around the bottle neck, grip the body and begin to turn the handle clockwise. Then turn the handle until the wings are upright and push the wings down using both hands. To remove the cork from the spiral, squeeze the cork and turn counter-clockwise. \u003cbr\u003eEasily removes corks. Clamps securely on top of wine bottles. Non-stick spiral won't break or crumble corks. Integrated bottle opener. Made from robust zinc alloy","published_at":"2023-11-06T21:51:26+00:00","created_at":"2023-11-06T21:49:11+00:00","vendor":"Kitchencraft","type":"","tags":["Christmas Gift Guide","KITCHENCRAFT","TABLE \u0026 BAR","WINE \u0026 BAR"],"price":1995,"price_min":1995,"price_max":1995,"available":false,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":47335651606873,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"BCSCREWWING","requires_shipping":true,"taxable":true,"featured_image":null,"available":false,"name":"BarCraft Winged Corkscrew, Black","public_title":null,"options":["Default Title"],"price":1995,"weight":0,"compare_at_price":null,"inventory_quantity":0,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5057982087197","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/wingedcorkscrew._81c92ab6-5eaa-4b3c-80e3-90aa305e0a48.jpg?v=1712950160","\/\/anvil.ie\/cdn\/shop\/files\/wingedcorkscrew.jpg?v=1712950146"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/wingedcorkscrew._81c92ab6-5eaa-4b3c-80e3-90aa305e0a48.jpg?v=1712950160","options":["Title"],"media":[{"alt":null,"id":46288388292953,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/files\/wingedcorkscrew._81c92ab6-5eaa-4b3c-80e3-90aa305e0a48.jpg?v=1712950160"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/wingedcorkscrew._81c92ab6-5eaa-4b3c-80e3-90aa305e0a48.jpg?v=1712950160","width":600},{"alt":null,"id":44312859246937,"position":3,"preview_image":{"aspect_ratio":1.0,"height":640,"width":640,"src":"\/\/anvil.ie\/cdn\/shop\/files\/wingedcorkscrew.jpg?v=1712950146"},"aspect_ratio":1.0,"height":640,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/wingedcorkscrew.jpg?v=1712950146","width":640}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"This heavy-duty Winged Corkscrew with bottle opener from BarCraft grips tightly to wine bottles and easily removes corks without crumbling. Made of a durable zinc alloy, it’s carefully crafted to combine modern design and stability. The non-stick spiral enables a clean removal, extracting the cork in one piece. To use, simply squeeze the winged corkscrew around the bottle neck, grip the body and begin to turn the handle clockwise. Then turn the handle until the wings are upright and push the wings down using both hands. To remove the cork from the spiral, squeeze the cork and turn counter-clockwise. \u003cbr\u003eEasily removes corks. Clamps securely on top of wine bottles. Non-stick spiral won't break or crumble corks. Integrated bottle opener. Made from robust zinc alloy"}
BarCraft Winged Corkscrew, Black

BarCraft Winged Corkscrew, Black

€19.95

This heavy-duty Winged Corkscrew with bottle opener from BarCraft grips tightly to wine bottles and easily removes corks without crumbling. Made of a durable zinc alloy, it’s carefully crafted to combine modern design and stability. The non-stick spiral enables a clean removal, extracting the cork in one piece. To use, simply squeeze the winged ...


More Info
Sale
Bialetti Moka Express Caffettiera/Espresso Maker, 3 Cup (S624)
{"id":386151120932,"title":"Bialetti Moka Express Caffettiera\/Espresso Maker, 3 Cup (S624)","handle":"bialetti-moka-express-caffettiera-espresso-maker-3-cup","description":"The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich, authentic espresso in just minutes. The aluminum pot features Bialetti’s distinctive eight-sided shape that allows it to diffuse heat perfectly to enhance the aroma of your coffee.Moka Express Espresso Maker features: Designed in Italy. Body made from top quality aluminium.Moulded resin handle stays cool during use. Ergonomically designed. Suitable for use on gas, electric and ceramic cooktops. Use on a low flame only, or you'll risk damaging your coffee maker. Hand wash in warm water only. Capacity: 3 Cups. 130ml. 4.4oz","published_at":"2020-11-16T21:08:18+00:00","created_at":"2017-11-23T10:10:47+00:00","vendor":"EA Symmons","type":"","tags":["Bialeti","BIALETTI","Bialetti Dublin","Bialetti Ireland","CAFETIERE","COFFEE MAKER","COFFEE PLUNGER","TABLE \u0026 BAR"],"price":2995,"price_min":2995,"price_max":2995,"available":true,"price_varies":false,"compare_at_price":3995,"compare_at_price_min":3995,"compare_at_price_max":3995,"compare_at_price_varies":false,"variants":[{"id":4992661487652,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"1162","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Bialetti Moka Express Caffettiera\/Espresso Maker, 3 Cup (S624)","public_title":null,"options":["Default Title"],"price":2995,"weight":0,"compare_at_price":3995,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"8006363011624","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/bialetti_20moka_20express_203_20cup.jpg?v=1511431847"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/bialetti_20moka_20express_203_20cup.jpg?v=1511431847","options":["Title"],"media":[{"alt":null,"id":728075763748,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/bialetti_20moka_20express_203_20cup.jpg?v=1511431847"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/bialetti_20moka_20express_203_20cup.jpg?v=1511431847","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich, authentic espresso in just minutes. The aluminum pot features Bialetti’s distinctive eight-sided shape that allows it to diffuse heat perfectly to enhance the aroma of your coffee.Moka Express Espresso Maker features: Designed in Italy. Body made from top quality aluminium.Moulded resin handle stays cool during use. Ergonomically designed. Suitable for use on gas, electric and ceramic cooktops. Use on a low flame only, or you'll risk damaging your coffee maker. Hand wash in warm water only. Capacity: 3 Cups. 130ml. 4.4oz"}
Bialetti Moka Express Caffettiera/Espresso Maker, 3 Cup (S624)

Bialetti Moka Express Caffettiera/Espresso Maker, 3 Cup (S624)

€29.95

The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich...


More Info
Sold out
Bialetti Moka Express Caffettiera/Espresso Maker, 6 Cup (S631)
{"id":386150891556,"title":"Bialetti Moka Express Caffettiera\/Espresso Maker, 6 Cup (S631)","handle":"bialetti-moka-express-caffettiera-espresso-maker-6-cup","description":"The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich, authentic espresso in just minutes. The aluminum pot features Bialetti’s distinctive eight-sided shape that allows it to diffuse heat perfectly to enhance the aroma of your coffee. Moka Express Espresso Maker features: Designed in Italy. Body made from top quality aluminium.Moulded resin handle stays cool during use. Ergonomically designed. Suitable for use on gas, electric and ceramic cooktops. Use on a low flame only, or you'll risk damaging your coffee maker. Hand wash in warm water only. Capacity: 6 Cups. 270ml. 9.1oz","published_at":"2020-11-16T21:08:19+00:00","created_at":"2017-11-23T10:10:42+00:00","vendor":"EA Symmons","type":"","tags":["Bialeti","BIALETTI","Bialetti Dublin","Bialetti Ireland","CAFETIERE","COFFEE MAKER","COFFEE PLUNGER","TABLE \u0026 BAR"],"price":3695,"price_min":3695,"price_max":3695,"available":false,"price_varies":false,"compare_at_price":4695,"compare_at_price_min":4695,"compare_at_price_max":4695,"compare_at_price_varies":false,"variants":[{"id":4992660897828,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"1163","requires_shipping":true,"taxable":true,"featured_image":null,"available":false,"name":"Bialetti Moka Express Caffettiera\/Espresso Maker, 6 Cup (S631)","public_title":null,"options":["Default Title"],"price":3695,"weight":0,"compare_at_price":4695,"inventory_quantity":0,"inventory_management":"shopify","inventory_policy":"deny","barcode":"8006363011631","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/bialetti_20moka_20express_206_20cup.jpg?v=1511431842"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/bialetti_20moka_20express_206_20cup.jpg?v=1511431842","options":["Title"],"media":[{"alt":null,"id":728075632676,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/bialetti_20moka_20express_206_20cup.jpg?v=1511431842"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/bialetti_20moka_20express_206_20cup.jpg?v=1511431842","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich, authentic espresso in just minutes. The aluminum pot features Bialetti’s distinctive eight-sided shape that allows it to diffuse heat perfectly to enhance the aroma of your coffee. Moka Express Espresso Maker features: Designed in Italy. Body made from top quality aluminium.Moulded resin handle stays cool during use. Ergonomically designed. Suitable for use on gas, electric and ceramic cooktops. Use on a low flame only, or you'll risk damaging your coffee maker. Hand wash in warm water only. Capacity: 6 Cups. 270ml. 9.1oz"}
Bialetti Moka Express Caffettiera/Espresso Maker, 6 Cup (S631)

Bialetti Moka Express Caffettiera/Espresso Maker, 6 Cup (S631)

€36.95

The Bialetti Moka celebrates more than 80 years of classic design elegance and technological simplicity. From the early 1950s to the present day, Bialetti has manufactured over 200 million coffee makers. In particular, the Moka Express has become iconic and has allowed millions of consumers to enjoy great Italian coffee. The Moka produces a rich...


More Info
{"id":8606558781785,"title":"Black Patterned Paper Doilies, 16 Piece","handle":"black-patterned-paper-doilies-12-piece","description":"Pack of 16 decorative paper doilies for cake, sandwich and buffet presentation. The doilies can also be used as an icing sugar stencil for cake decoration.  Sizes: 20cm","published_at":"2023-12-10T21:53:46+00:00","created_at":"2023-12-10T21:47:06+00:00","vendor":"DECORA","type":"","tags":["BAKING SUPPLIES DUBLIN","BAKING SUPPLIES IRELAND","KITCHENCRAFT"],"price":495,"price_min":495,"price_max":495,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":47531926061401,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"0265882","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Black Patterned Paper Doilies, 16 Piece","public_title":null,"options":["Default Title"],"price":495,"weight":0,"compare_at_price":null,"inventory_quantity":12,"inventory_management":"shopify","inventory_policy":"deny","barcode":"070896202192","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/blackpaperdoilies.jpg?v=1702244951","\/\/anvil.ie\/cdn\/shop\/files\/blackpaperdoilies..jpg?v=1702245195"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/blackpaperdoilies.jpg?v=1702244951","options":["Title"],"media":[{"alt":null,"id":44708939661657,"position":1,"preview_image":{"aspect_ratio":1.0,"height":255,"width":255,"src":"\/\/anvil.ie\/cdn\/shop\/files\/blackpaperdoilies.jpg?v=1702244951"},"aspect_ratio":1.0,"height":255,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/blackpaperdoilies.jpg?v=1702244951","width":255},{"alt":null,"id":44708973314393,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/files\/blackpaperdoilies..jpg?v=1702245195"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/blackpaperdoilies..jpg?v=1702245195","width":600}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"Pack of 16 decorative paper doilies for cake, sandwich and buffet presentation. The doilies can also be used as an icing sugar stencil for cake decoration.  Sizes: 20cm"}
Black Patterned Paper Doilies, 16 Piece

Black Patterned Paper Doilies, 16 Piece

€4.95

Pack of 16 decorative paper doilies for cake, sandwich and buffet presentation. The doilies can also be used as an icing sugar stencil for cake decoration.  Sizes: 20cm


More Info
Sale
Blue Willow Pattern 20 Piece Dinner Set
{"id":8454733693273,"title":"Blue Willow Pattern 20 Piece Dinner Set","handle":"blue-willow-20-piece-dinner-set","description":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThe Blue Willow Pattern 20 piece set comprises 4 x 27cm dinner plates, 4 x 19cm side plates, 4 x 15cm cereal \/ soup bowls, 4 tea cups and 4 saucers.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eApproximate Size: Dinner plate - 27cm, side plate - 19cm, cereal\/soup bowl - 15cm wide x 6cm high, tea cup (excluding handle) 9cm wide x 7cm high, saucer - 14cm.\u003c\/span\u003e\u003c\/p\u003e","published_at":"2023-07-05T15:18:02+01:00","created_at":"2023-07-05T14:58:41+01:00","vendor":"Dunlevy","type":"","tags":["blue willow","MOTHERS DAY","TABLE \u0026 BAR","willow pattern"],"price":12495,"price_min":12495,"price_max":12495,"available":true,"price_varies":false,"compare_at_price":14495,"compare_at_price_min":14495,"compare_at_price_max":14495,"compare_at_price_varies":false,"variants":[{"id":46874887291225,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"DE2120SET","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Blue Willow Pattern 20 Piece Dinner Set","public_title":null,"options":["Default Title"],"price":12495,"weight":0,"compare_at_price":14495,"inventory_quantity":2,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5391125142894","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/BLUEWILLOWSET.jpg?v=1688566738","\/\/anvil.ie\/cdn\/shop\/files\/BLUEWILLOWSET2_1.jpg?v=1688566545","\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatterndinnerplate.jpg?v=1688677282","\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatternsideplate.jpg?v=1688677282","\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatterncerealbowl_0e78d37f-15b8-4598-87e7-855e89a8d82c.jpg?v=1688677282","\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatternteacupandsaucer.jpg?v=1688677517"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/BLUEWILLOWSET.jpg?v=1688566738","options":["Title"],"media":[{"alt":null,"id":43056477667673,"position":1,"preview_image":{"aspect_ratio":1.257,"height":467,"width":587,"src":"\/\/anvil.ie\/cdn\/shop\/files\/BLUEWILLOWSET.jpg?v=1688566738"},"aspect_ratio":1.257,"height":467,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/BLUEWILLOWSET.jpg?v=1688566738","width":587},{"alt":null,"id":43056478683481,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/files\/BLUEWILLOWSET2_1.jpg?v=1688566545"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/BLUEWILLOWSET2_1.jpg?v=1688566545","width":600},{"alt":null,"id":43071238111577,"position":3,"preview_image":{"aspect_ratio":1.0,"height":765,"width":765,"src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatterndinnerplate.jpg?v=1688677282"},"aspect_ratio":1.0,"height":765,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatterndinnerplate.jpg?v=1688677282","width":765},{"alt":null,"id":43071238078809,"position":4,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatternsideplate.jpg?v=1688677282"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatternsideplate.jpg?v=1688677282","width":700},{"alt":null,"id":43071238046041,"position":5,"preview_image":{"aspect_ratio":1.0,"height":1000,"width":1000,"src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatterncerealbowl_0e78d37f-15b8-4598-87e7-855e89a8d82c.jpg?v=1688677282"},"aspect_ratio":1.0,"height":1000,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatterncerealbowl_0e78d37f-15b8-4598-87e7-855e89a8d82c.jpg?v=1688677282","width":1000},{"alt":null,"id":43071261868377,"position":6,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatternteacupandsaucer.jpg?v=1688677517"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatternteacupandsaucer.jpg?v=1688677517","width":700}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThe Blue Willow Pattern 20 piece set comprises 4 x 27cm dinner plates, 4 x 19cm side plates, 4 x 15cm cereal \/ soup bowls, 4 tea cups and 4 saucers.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eApproximate Size: Dinner plate - 27cm, side plate - 19cm, cereal\/soup bowl - 15cm wide x 6cm high, tea cup (excluding handle) 9cm wide x 7cm high, saucer - 14cm.\u003c\/span\u003e\u003c\/p\u003e"}
Blue Willow Pattern 20 Piece Dinner Set

Blue Willow Pattern 20 Piece Dinner Set

€124.95

Blue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality...


More Info
{"id":385061748772,"title":"Blue Willow Pattern Barrel Mug, 340ml (D072)","handle":"churchill-willow-pattern-dream-mug-340ml","description":"\u003cp\u003e\u003cmeta charset=\"utf-8\"\u003e\u003cspan\u003eBlue Willow Pattern is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. It comes in a range of colours with Blue Willow Pattern being one of the most popular. Blue Willow Pattern is available in a full range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted ceramic earthenware is dishwasher and microwave safe.\u003c\/span\u003e\u003cbr\u003e\u003cbr\u003e\u003cspan\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow Pattern pieces are classic and encompass the traditional feel that has made Willow Pattern world famous.\u003c\/span\u003e\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eBlue Willow Pattern Barrel Mug, 340ml\u003c\/span\u003e\u003c\/p\u003e","published_at":"2021-04-19T22:29:39+01:00","created_at":"2017-11-22T14:19:39+00:00","vendor":"Dunlevy","type":"","tags":["blue willow","TABLE \u0026 BAR","willow pattern"],"price":495,"price_min":495,"price_max":495,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":4985115672612,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"de8072","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Blue Willow Pattern Barrel Mug, 340ml (D072)","public_title":null,"options":["Default Title"],"price":495,"weight":0,"compare_at_price":null,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/products\/churchill_20willow_20pattern_20blue_20willow_20_20dream_20mug.jpg?v=1622671222"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/products\/churchill_20willow_20pattern_20blue_20willow_20_20dream_20mug.jpg?v=1622671222","options":["Title"],"media":[{"alt":"Churchill Blue Willow Pattern Mug ","id":727021355044,"position":1,"preview_image":{"aspect_ratio":1.0,"height":500,"width":500,"src":"\/\/anvil.ie\/cdn\/shop\/products\/churchill_20willow_20pattern_20blue_20willow_20_20dream_20mug.jpg?v=1622671222"},"aspect_ratio":1.0,"height":500,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/churchill_20willow_20pattern_20blue_20willow_20_20dream_20mug.jpg?v=1622671222","width":500}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003e\u003cmeta charset=\"utf-8\"\u003e\u003cspan\u003eBlue Willow Pattern is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. It comes in a range of colours with Blue Willow Pattern being one of the most popular. Blue Willow Pattern is available in a full range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted ceramic earthenware is dishwasher and microwave safe.\u003c\/span\u003e\u003cbr\u003e\u003cbr\u003e\u003cspan\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow Pattern pieces are classic and encompass the traditional feel that has made Willow Pattern world famous.\u003c\/span\u003e\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eBlue Willow Pattern Barrel Mug, 340ml\u003c\/span\u003e\u003c\/p\u003e"}
Churchill Blue Willow Pattern Mug

Blue Willow Pattern Barrel Mug, 340ml (D072)

€4.95

Blue Willow Pattern is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. It comes in a range of colours with Blue Willow Pattern being one of the most popular. Blue Willow Pattern is available in a full range of tableware which includes plates, bowls, ...


More Info
{"id":8454957171033,"title":"Blue Willow Pattern Breakfast \u0026 Salad Plate, 23cm","handle":"blue-willow-breakfast-salad-plate-23cm","description":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Breakfast \u0026amp; Salad Plate, 23cm\u003c\/p\u003e","published_at":"2023-07-06T16:04:19+01:00","created_at":"2023-07-05T16:54:44+01:00","vendor":"Dunlevy","type":"","tags":["blue willow","MOTHERS DAY","TABLE \u0026 BAR","willow pattern"],"price":795,"price_min":795,"price_max":795,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":46875376812377,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"DE2009","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Blue Willow Pattern Breakfast \u0026 Salad Plate, 23cm","public_title":null,"options":["Default Title"],"price":795,"weight":0,"compare_at_price":null,"inventory_quantity":57,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5391125142733","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/bluewillowbreakfastplate.jpg?v=1688572623","\/\/anvil.ie\/cdn\/shop\/files\/bluewillowbreakfastplate_25faa80e-436f-4cb3-96db-7283c6e3e52e.jpg?v=1688656761"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowbreakfastplate.jpg?v=1688572623","options":["Title"],"media":[{"alt":null,"id":43057879384409,"position":1,"preview_image":{"aspect_ratio":1.0,"height":800,"width":800,"src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowbreakfastplate.jpg?v=1688572623"},"aspect_ratio":1.0,"height":800,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowbreakfastplate.jpg?v=1688572623","width":800},{"alt":null,"id":43069062742361,"position":2,"preview_image":{"aspect_ratio":1.0,"height":464,"width":464,"src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowbreakfastplate_25faa80e-436f-4cb3-96db-7283c6e3e52e.jpg?v=1688656761"},"aspect_ratio":1.0,"height":464,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowbreakfastplate_25faa80e-436f-4cb3-96db-7283c6e3e52e.jpg?v=1688656761","width":464}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Breakfast \u0026amp; Salad Plate, 23cm\u003c\/p\u003e"}
Blue Willow Pattern Breakfast & Salad Plate, 23cm

Blue Willow Pattern Breakfast & Salad Plate, 23cm

€7.95

Blue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality...


More Info
{"id":8455546339673,"title":"Blue Willow Pattern Cereal \u0026 Soup Bowl, 15cm","handle":"blue-willow-pattern-cereal-soup-bowl-15cm","description":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Cereal \u0026amp; Soup Bowl, 15cm wide x 6cm high\u003c\/p\u003e","published_at":"2023-07-06T12:16:56+01:00","created_at":"2023-07-06T12:12:26+01:00","vendor":"Dunlevy","type":"","tags":["blue willow","MOTHERS DAY","TABLE \u0026 BAR","willow pattern"],"price":650,"price_min":650,"price_max":650,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":46878278746457,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"DE2006 (from set \u0026 separate order)","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Blue Willow Pattern Cereal \u0026 Soup Bowl, 15cm","public_title":null,"options":["Default Title"],"price":650,"weight":0,"compare_at_price":null,"inventory_quantity":14,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5391125142764","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/DE2006cerealbowlbluewillowpattern.jpg?v=1688642353","\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatterncerealbowl.jpg?v=1688678501","\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatterncerealbowl_5a1958cf-5039-4c13-b6cb-9ff3dba31f13.jpg?v=1688678529"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/DE2006cerealbowlbluewillowpattern.jpg?v=1688642353","options":["Title"],"media":[{"alt":null,"id":43067195818329,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/files\/DE2006cerealbowlbluewillowpattern.jpg?v=1688642353"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/DE2006cerealbowlbluewillowpattern.jpg?v=1688642353","width":700},{"alt":null,"id":43071231328601,"position":2,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatterncerealbowl.jpg?v=1688678501"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatterncerealbowl.jpg?v=1688678501","width":700},{"alt":null,"id":43071345492313,"position":3,"preview_image":{"aspect_ratio":1.0,"height":645,"width":645,"src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatterncerealbowl_5a1958cf-5039-4c13-b6cb-9ff3dba31f13.jpg?v=1688678529"},"aspect_ratio":1.0,"height":645,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatterncerealbowl_5a1958cf-5039-4c13-b6cb-9ff3dba31f13.jpg?v=1688678529","width":645}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Cereal \u0026amp; Soup Bowl, 15cm wide x 6cm high\u003c\/p\u003e"}
Blue Willow Pattern Cereal & Soup Bowl, 15cm

Blue Willow Pattern Cereal & Soup Bowl, 15cm

€6.50

Blue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality...


More Info
{"id":8454976995673,"title":"Blue Willow Pattern Covered Butter Dish","handle":"blue-willow-covered-butter-dish","description":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Covered Butter Dish. Approx Size: 15.5cm x 10.5cm\u003c\/p\u003e","published_at":"2023-07-05T17:25:42+01:00","created_at":"2023-07-05T17:22:51+01:00","vendor":"Dunlevy","type":"","tags":["blue willow","MOTHERS DAY","TABLE \u0026 BAR","willow pattern"],"price":2495,"price_min":2495,"price_max":2495,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":46875496579417,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"DE2019","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Blue Willow Pattern Covered Butter Dish","public_title":null,"options":["Default Title"],"price":2495,"weight":0,"compare_at_price":null,"inventory_quantity":4,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5391125142856","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/willowbutterdish.jpg?v=1712788033","\/\/anvil.ie\/cdn\/shop\/files\/de2019bluewillowbutterdishweb_2204b8ce-0fb8-4129-8801-a8fec85490b8.jpg?v=1712788008"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/willowbutterdish.jpg?v=1712788033","options":["Title"],"media":[{"alt":null,"id":46265840140633,"position":1,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/files\/willowbutterdish.jpg?v=1712788033"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/willowbutterdish.jpg?v=1712788033","width":600},{"alt":null,"id":43071370395993,"position":2,"preview_image":{"aspect_ratio":1.0,"height":571,"width":571,"src":"\/\/anvil.ie\/cdn\/shop\/files\/de2019bluewillowbutterdishweb_2204b8ce-0fb8-4129-8801-a8fec85490b8.jpg?v=1712788008"},"aspect_ratio":1.0,"height":571,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/de2019bluewillowbutterdishweb_2204b8ce-0fb8-4129-8801-a8fec85490b8.jpg?v=1712788008","width":571}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Covered Butter Dish. Approx Size: 15.5cm x 10.5cm\u003c\/p\u003e"}
Blue Willow Pattern Covered Butter Dish

Blue Willow Pattern Covered Butter Dish

€24.95

Blue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality...


More Info
{"id":8455042629977,"title":"Blue Willow Pattern Covered Sugar Bowl","handle":"blue-willow-covered-sugar-bowl","description":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Covered Sugar Bowl. Approx size excluding lid: 9cm wide x 6cm high.\u003c\/p\u003e","published_at":"2023-07-05T18:34:56+01:00","created_at":"2023-07-05T18:33:33+01:00","vendor":"Dunlevy","type":"","tags":["blue willow","MOTHERS DAY","TABLE \u0026 BAR","willow pattern"],"price":995,"price_min":995,"price_max":995,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":46875689484633,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"DE2021S","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Blue Willow Pattern Covered Sugar Bowl","public_title":null,"options":["Default Title"],"price":995,"weight":0,"compare_at_price":null,"inventory_quantity":4,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5391125142825","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/DE2022Sbluewillowpatternsugarbowlweb.jpg?v=1688676186","\/\/anvil.ie\/cdn\/shop\/files\/DE2022Sbluewillowpatternsugarbowlweb_17084fbc-bf3a-47ab-a12a-58ee879969ab.jpg?v=1688676235"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/DE2022Sbluewillowpatternsugarbowlweb.jpg?v=1688676186","options":["Title"],"media":[{"alt":null,"id":43058750325081,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/files\/DE2022Sbluewillowpatternsugarbowlweb.jpg?v=1688676186"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/DE2022Sbluewillowpatternsugarbowlweb.jpg?v=1688676186","width":700},{"alt":null,"id":43071155011929,"position":2,"preview_image":{"aspect_ratio":1.0,"height":491,"width":491,"src":"\/\/anvil.ie\/cdn\/shop\/files\/DE2022Sbluewillowpatternsugarbowlweb_17084fbc-bf3a-47ab-a12a-58ee879969ab.jpg?v=1688676235"},"aspect_ratio":1.0,"height":491,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/DE2022Sbluewillowpatternsugarbowlweb_17084fbc-bf3a-47ab-a12a-58ee879969ab.jpg?v=1688676235","width":491}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Covered Sugar Bowl. Approx size excluding lid: 9cm wide x 6cm high.\u003c\/p\u003e"}
Blue Willow Pattern Covered Sugar Bowl

Blue Willow Pattern Covered Sugar Bowl

€9.95

Blue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality...


More Info
{"id":8455043449177,"title":"Blue Willow Pattern Cream Jug, 7oz","handle":"blue-willow-covered-cream-jug","description":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Cream Jug, 7oz\u003c\/p\u003e","published_at":"2023-07-05T18:42:34+01:00","created_at":"2023-07-05T18:36:07+01:00","vendor":"Dunlevy","type":"","tags":["blue willow","MOTHERS DAY","TABLE \u0026 BAR","willow pattern"],"price":995,"price_min":995,"price_max":995,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":46875702329689,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"DE2022C","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Blue Willow Pattern Cream Jug, 7oz","public_title":null,"options":["Default Title"],"price":995,"weight":0,"compare_at_price":null,"inventory_quantity":5,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5391125142832","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/de2022cbluewillowpatterncreamjugweb.jpg?v=1688676295","\/\/anvil.ie\/cdn\/shop\/files\/de2022cbluewillowpatterncreamjugweb_781bd135-555f-494b-a147-062682a7b952.jpg?v=1688676343"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/de2022cbluewillowpatterncreamjugweb.jpg?v=1688676295","options":["Title"],"media":[{"alt":null,"id":43058779357529,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/files\/de2022cbluewillowpatterncreamjugweb.jpg?v=1688676295"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/de2022cbluewillowpatterncreamjugweb.jpg?v=1688676295","width":700},{"alt":null,"id":43071162483033,"position":2,"preview_image":{"aspect_ratio":1.0,"height":567,"width":567,"src":"\/\/anvil.ie\/cdn\/shop\/files\/de2022cbluewillowpatterncreamjugweb_781bd135-555f-494b-a147-062682a7b952.jpg?v=1688676343"},"aspect_ratio":1.0,"height":567,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/de2022cbluewillowpatterncreamjugweb_781bd135-555f-494b-a147-062682a7b952.jpg?v=1688676343","width":567}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Cream Jug, 7oz\u003c\/p\u003e"}
Blue Willow Pattern Cream Jug, 7oz

Blue Willow Pattern Cream Jug, 7oz

€9.95

Blue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality...


More Info
{"id":8455575896409,"title":"Blue Willow Pattern Cup \u0026 Saucer (Sold Separately)","handle":"blue-willow-pattern-cup-saucer-sold-separately-1","description":"\u003cp\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003cbr\u003e\u003cbr\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003cbr\u003eBlue Willow Pattern Cup \u0026amp; Saucer (Sold Separately). Approx size: 8oz tea cup, (excluding handle) 9cm wide x 7cm high, saucer - 14cm.\u003c\/p\u003e","published_at":"2023-07-06T13:07:22+01:00","created_at":"2023-07-06T12:55:53+01:00","vendor":"Dunlevy","type":"","tags":["blue willow","TABLE \u0026 BAR","willow pattern"],"price":495,"price_min":495,"price_max":650,"available":true,"price_varies":true,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":46878411293017,"title":"Cup","option1":"Cup","option2":null,"option3":null,"sku":"de2000 (from set)","requires_shipping":true,"taxable":true,"featured_image":{"id":50071448355161,"product_id":8455575896409,"position":3,"created_at":"2023-07-06T13:05:29+01:00","updated_at":"2023-07-06T13:09:02+01:00","alt":null,"width":850,"height":850,"src":"\/\/anvil.ie\/cdn\/shop\/products\/bluewillowpatternteacup1.jpg?v=1688645342","variant_ids":[46878411293017]},"available":true,"name":"Blue Willow Pattern Cup \u0026 Saucer (Sold Separately) - Cup","public_title":"Cup","options":["Cup"],"price":650,"weight":0,"compare_at_price":null,"inventory_quantity":14,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5391125142849","featured_media":{"alt":null,"id":43067638645081,"position":3,"preview_image":{"aspect_ratio":1.0,"height":850,"width":850,"src":"\/\/anvil.ie\/cdn\/shop\/products\/bluewillowpatternteacup1.jpg?v=1688645342"}},"requires_selling_plan":false,"selling_plan_allocations":[]},{"id":46878411325785,"title":"Saucer","option1":"Saucer","option2":null,"option3":null,"sku":"de2001 (from set)","requires_shipping":true,"taxable":true,"featured_image":{"id":50075015938393,"product_id":8455575896409,"position":5,"created_at":"2023-07-06T22:03:57+01:00","updated_at":"2023-07-06T22:04:00+01:00","alt":null,"width":992,"height":992,"src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowteasaucer..jpg?v=1688677440","variant_ids":[46878411325785]},"available":true,"name":"Blue Willow Pattern Cup \u0026 Saucer (Sold Separately) - Saucer","public_title":"Saucer","options":["Saucer"],"price":495,"weight":0,"compare_at_price":null,"inventory_quantity":19,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5391125142740","featured_media":{"alt":null,"id":43071254167897,"position":5,"preview_image":{"aspect_ratio":1.0,"height":992,"width":992,"src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowteasaucer..jpg?v=1688677440"}},"requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatternteacupandsaucer._b0b2b9e0-cd82-418d-9860-075a1ed04b73.jpg?v=1688645367","\/\/anvil.ie\/cdn\/shop\/files\/bluewillowteacupandsaucer_197bf444-1f14-467b-b494-54193a8d5567.jpg?v=1688645342","\/\/anvil.ie\/cdn\/shop\/products\/bluewillowpatternteacup1.jpg?v=1688645342","\/\/anvil.ie\/cdn\/shop\/files\/willowpatternteasaucer.jpg?v=1688663865","\/\/anvil.ie\/cdn\/shop\/files\/bluewillowteasaucer..jpg?v=1688677440"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatternteacupandsaucer._b0b2b9e0-cd82-418d-9860-075a1ed04b73.jpg?v=1688645367","options":["Type"],"media":[{"alt":null,"id":43067669381465,"position":1,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatternteacupandsaucer._b0b2b9e0-cd82-418d-9860-075a1ed04b73.jpg?v=1688645367"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowpatternteacupandsaucer._b0b2b9e0-cd82-418d-9860-075a1ed04b73.jpg?v=1688645367","width":700},{"alt":null,"id":43067537949017,"position":2,"preview_image":{"aspect_ratio":1.0,"height":600,"width":600,"src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowteacupandsaucer_197bf444-1f14-467b-b494-54193a8d5567.jpg?v=1688645342"},"aspect_ratio":1.0,"height":600,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowteacupandsaucer_197bf444-1f14-467b-b494-54193a8d5567.jpg?v=1688645342","width":600},{"alt":null,"id":43067638645081,"position":3,"preview_image":{"aspect_ratio":1.0,"height":850,"width":850,"src":"\/\/anvil.ie\/cdn\/shop\/products\/bluewillowpatternteacup1.jpg?v=1688645342"},"aspect_ratio":1.0,"height":850,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/products\/bluewillowpatternteacup1.jpg?v=1688645342","width":850},{"alt":null,"id":43069911695705,"position":4,"preview_image":{"aspect_ratio":1.0,"height":850,"width":850,"src":"\/\/anvil.ie\/cdn\/shop\/files\/willowpatternteasaucer.jpg?v=1688663865"},"aspect_ratio":1.0,"height":850,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/willowpatternteasaucer.jpg?v=1688663865","width":850},{"alt":null,"id":43071254167897,"position":5,"preview_image":{"aspect_ratio":1.0,"height":992,"width":992,"src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowteasaucer..jpg?v=1688677440"},"aspect_ratio":1.0,"height":992,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowteasaucer..jpg?v=1688677440","width":992}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003cbr\u003e\u003cbr\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003cbr\u003eBlue Willow Pattern Cup \u0026amp; Saucer (Sold Separately). Approx size: 8oz tea cup, (excluding handle) 9cm wide x 7cm high, saucer - 14cm.\u003c\/p\u003e"}
Blue Willow Pattern Cup & Saucer (Sold Separately)

Blue Willow Pattern Cup & Saucer (Sold Separately)

€6.50

Blue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality...


More Info
{"id":8455529333081,"title":"Blue Willow Pattern Dinner Plate, 27cm","handle":"blue-willow-pattern-dinner-plate-27cm","description":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Dinner Plate, 27cm\u003c\/p\u003e","published_at":"2023-07-06T11:48:06+01:00","created_at":"2023-07-06T11:43:09+01:00","vendor":"Dunlevy","type":"","tags":["blue willow","MOTHERS DAY","TABLE \u0026 BAR","willow pattern"],"price":1050,"price_min":1050,"price_max":1050,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":46878220386649,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"DE2010 (from set)","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Blue Willow Pattern Dinner Plate, 27cm","public_title":null,"options":["Default Title"],"price":1050,"weight":0,"compare_at_price":null,"inventory_quantity":6,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5391125142719","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/DE201027CMDINNERPLATEWILLOWPATTERNWEB.jpg?v=1688641627","\/\/anvil.ie\/cdn\/shop\/files\/bluewillowdinnerplate.jpg?v=1688678614"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/DE201027CMDINNERPLATEWILLOWPATTERNWEB.jpg?v=1688641627","options":["Title"],"media":[{"alt":null,"id":43066894287193,"position":1,"preview_image":{"aspect_ratio":1.0,"height":765,"width":765,"src":"\/\/anvil.ie\/cdn\/shop\/files\/DE201027CMDINNERPLATEWILLOWPATTERNWEB.jpg?v=1688641627"},"aspect_ratio":1.0,"height":765,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/DE201027CMDINNERPLATEWILLOWPATTERNWEB.jpg?v=1688641627","width":765},{"alt":null,"id":43071351652697,"position":2,"preview_image":{"aspect_ratio":1.0,"height":567,"width":567,"src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowdinnerplate.jpg?v=1688678614"},"aspect_ratio":1.0,"height":567,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/bluewillowdinnerplate.jpg?v=1688678614","width":567}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Dinner Plate, 27cm\u003c\/p\u003e"}
Blue Willow Pattern Dinner Plate, 27cm

Blue Willow Pattern Dinner Plate, 27cm

€10.50

Blue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality...


More Info
{"id":8455424573785,"title":"Blue Willow Pattern Egg Cup","handle":"blue-willow-egg-cup","description":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Egg Cup\u003c\/p\u003e","published_at":"2023-07-06T09:53:49+01:00","created_at":"2023-07-06T09:31:11+01:00","vendor":"Dunlevy","type":"","tags":["blue willow","MOTHERS DAY","TABLE \u0026 BAR","willow pattern"],"price":450,"price_min":450,"price_max":450,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":46877862232409,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"DE32WIL","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Blue Willow Pattern Egg Cup","public_title":null,"options":["Default Title"],"price":450,"weight":0,"compare_at_price":null,"inventory_quantity":8,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5391125142702","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/IMG_2159bluewilloweggcup_cb5dc021-fc26-4436-85f6-107f4fbd2c08.jpg?v=1688633800"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/IMG_2159bluewilloweggcup_cb5dc021-fc26-4436-85f6-107f4fbd2c08.jpg?v=1688633800","options":["Title"],"media":[{"alt":null,"id":43065659162969,"position":1,"preview_image":{"aspect_ratio":1.0,"height":1000,"width":1000,"src":"\/\/anvil.ie\/cdn\/shop\/files\/IMG_2159bluewilloweggcup_cb5dc021-fc26-4436-85f6-107f4fbd2c08.jpg?v=1688633800"},"aspect_ratio":1.0,"height":1000,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/IMG_2159bluewilloweggcup_cb5dc021-fc26-4436-85f6-107f4fbd2c08.jpg?v=1688633800","width":1000}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Egg Cup\u003c\/p\u003e"}
Blue Willow Pattern Egg Cup

Blue Willow Pattern Egg Cup

€4.50

Blue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality...


More Info
{"id":8455442104665,"title":"Blue Willow Pattern Oval Platter, 35cm","handle":"blue-willow-oval-platter","description":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eBlue Willow Pattern Oval Platter, 35cm. Approx size: 35cm x 28cm\u003c\/span\u003e\u003c\/p\u003e","published_at":"2023-07-06T10:11:48+01:00","created_at":"2023-07-06T10:09:13+01:00","vendor":"Dunlevy","type":"","tags":["blue willow","MOTHERS DAY","TABLE \u0026 BAR","willow pattern"],"price":4495,"price_min":4495,"price_max":4495,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":46877927571801,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"DE2035","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Blue Willow Pattern Oval Platter, 35cm","public_title":null,"options":["Default Title"],"price":4495,"weight":0,"compare_at_price":null,"inventory_quantity":3,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5391125142788","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/DE203535CMPlatterbluewillowpattern.jpg?v=1688634702","\/\/anvil.ie\/cdn\/shop\/files\/DE203535CMPlatterbluewillowpattern_6eb33643-8a56-4b76-8a6b-c37fdb52dd9e.jpg?v=1688651912"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/DE203535CMPlatterbluewillowpattern.jpg?v=1688634702","options":["Title"],"media":[{"alt":null,"id":43065779650905,"position":1,"preview_image":{"aspect_ratio":1.258,"height":636,"width":800,"src":"\/\/anvil.ie\/cdn\/shop\/files\/DE203535CMPlatterbluewillowpattern.jpg?v=1688634702"},"aspect_ratio":1.258,"height":636,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/DE203535CMPlatterbluewillowpattern.jpg?v=1688634702","width":800},{"alt":null,"id":43068411085145,"position":2,"preview_image":{"aspect_ratio":1.0,"height":676,"width":676,"src":"\/\/anvil.ie\/cdn\/shop\/files\/DE203535CMPlatterbluewillowpattern_6eb33643-8a56-4b76-8a6b-c37fdb52dd9e.jpg?v=1688651912"},"aspect_ratio":1.0,"height":676,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/DE203535CMPlatterbluewillowpattern_6eb33643-8a56-4b76-8a6b-c37fdb52dd9e.jpg?v=1688651912","width":676}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eBlue Willow Pattern Oval Platter, 35cm. Approx size: 35cm x 28cm\u003c\/span\u003e\u003c\/p\u003e"}
Blue Willow Pattern Oval Platter, 35cm

Blue Willow Pattern Oval Platter, 35cm

€44.95

Blue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality...


More Info
{"id":8455834337625,"title":"Blue Willow Pattern Pasta Serving Dish, 29cm","handle":"blue-willow-pattern-pasta-serving-dish-29cm","description":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Pasta Serving Dish, 29cm. Approx size: 29cm x 6cm\u003c\/p\u003e","published_at":"2023-07-06T17:13:36+01:00","created_at":"2023-07-06T16:56:11+01:00","vendor":"Dunlevy","type":"","tags":["blue willow","MOTHERS DAY","TABLE \u0026 BAR","willow pattern"],"price":2995,"price_min":2995,"price_max":2995,"available":true,"price_varies":false,"compare_at_price":null,"compare_at_price_min":0,"compare_at_price_max":0,"compare_at_price_varies":false,"variants":[{"id":46879297536345,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"DE2028 (average with older pasta dish)","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Blue Willow Pattern Pasta Serving Dish, 29cm","public_title":null,"options":["Default Title"],"price":2995,"weight":0,"compare_at_price":null,"inventory_quantity":1,"inventory_management":"shopify","inventory_policy":"deny","barcode":"5391125142863","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/anvil.ie\/cdn\/shop\/files\/de2028bluewillowpastaservingdish.jpg?v=1688660120","\/\/anvil.ie\/cdn\/shop\/files\/de2028.1pastaservingdishbluewillow.jpg?v=1688678209"],"featured_image":"\/\/anvil.ie\/cdn\/shop\/files\/de2028bluewillowpastaservingdish.jpg?v=1688660120","options":["Title"],"media":[{"alt":null,"id":43069395534169,"position":1,"preview_image":{"aspect_ratio":1.102,"height":668,"width":736,"src":"\/\/anvil.ie\/cdn\/shop\/files\/de2028bluewillowpastaservingdish.jpg?v=1688660120"},"aspect_ratio":1.102,"height":668,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/de2028bluewillowpastaservingdish.jpg?v=1688660120","width":736},{"alt":null,"id":43069398745433,"position":2,"preview_image":{"aspect_ratio":1.0,"height":700,"width":700,"src":"\/\/anvil.ie\/cdn\/shop\/files\/de2028.1pastaservingdishbluewillow.jpg?v=1688678209"},"aspect_ratio":1.0,"height":700,"media_type":"image","src":"\/\/anvil.ie\/cdn\/shop\/files\/de2028.1pastaservingdishbluewillow.jpg?v=1688678209","width":700}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003e\u003cspan\u003e\u003c\/span\u003e\u003cspan\u003eBlue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality handcrafted tableware is dishwasher and microwave safe.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eThe legend of Blue Willow Pattern is a story of forbidden love in ancient times. Clouded by the mists of time, the tale goes that to escape the wrath of her rich father, a young girl elopes with her lover. Discovered on a small boat, the young lovers escape his wrath when divine intervention turns them into a pair of turtle doves. The boat, the birds, the willow tree, the bridge, the pagoda all combine into an eloquent design that tells the tragic story. These Blue Willow pieces are classic and encompass the traditional feel that has made Willow Pattern world famous. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eBlue Willow Pattern Pasta Serving Dish, 29cm. Approx size: 29cm x 6cm\u003c\/p\u003e"}
Blue Willow Pattern Pasta Serving Dish, 29cm

Blue Willow Pattern Pasta Serving Dish, 29cm

€29.95

Blue Willow is one of the most famous and enduring designs. It has a distinctive and elaborate Chinese pattern which is used on tableware and other housewares. Blue Willow is available in an extensive range of tableware which includes plates, bowls, mugs, cups, cake stands, teapots, jugs, sugar bowls, gravy boats and serving dishes. This quality...


More Info